Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human BAX Antibody Antibody (6A7)

  • ARO-A14609-50
  • Validated ELISA FC

Original price was: $364.00.Current price is: $284.00.

50ug 22% OFF + 284 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Anti-Human BAX Antibody Antibody (6A7)
Anti-Human BAX Antibody Antibody (6A7) binds to Recombinant Human BAX Protein, N-His in ELISA Assay
Anti-Human BAX Antibody Antibody (6A7)

Anti-Human BAX Antibody Antibody (6A7)

Product name ARO-A14609-100
Uniprot ID Q07812
Raw Antigen Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14609
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen BAX, Bcl2-L-4, BCL2L4, Bcl-2-like protein 4, Apoptosis regulator BAX
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14609-1MG
Uniprot ID Q07812
Raw Antigen Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14609
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen BAX, Bcl2-L-4, BCL2L4, Bcl-2-like protein 4, Apoptosis regulator BAX
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14609-50
Uniprot ID Q07812
Raw Antigen Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14609
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen BAX, Bcl2-L-4, BCL2L4, Bcl-2-like protein 4, Apoptosis regulator BAX
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Anti-Human BAX Antibody Antibody (6A7)

Flow Cytometry results for Anti-Human BAX Antibody Antibody (6A7)

Target Cells were stained with an irrelevant antibody or Anti-Human BAX Antibody Antibody (6A7) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human BAX Antibody Antibody (6A7) binds to Recombinant Human BAX Protein, N-His in ELISA Assay

Anti-Human BAX Antibody Antibody (6A7) binds to Recombinant Human BAX Protein, N-His in ELISA Assay

Recombinant Human BAX Protein, N-His(cat. No.ARO-P15100) at 0.5µg/mL (100µL/well) can bind Anti-Human BAX Antibody Antibody (6A7) in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Human BAX Antibody Antibody (6A7)

There are no reviews yet.

Be the first to review “Anti-Human BAX Antibody Antibody (6A7)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products