Brand: ProteoGenix

Anti-Human CCL20/MIP-3-alpha (GSK3050002)

PTX25517-100
Quality Chart

Clonality:: Monoclonal Antibody
Isotype:: IgG

Original price was: $564.00.Current price is: $451.00.

100ug 20% OFF + 451 loyalty points

Size Size

50ug Original price was: $422.00.Current price is: $315.00.
100ug Original price was: $564.00.Current price is: $451.00.
1MG Original price was: $1,740.00.Current price is: $1,308.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human CCL20/MIP-3-alpha (GSK3050002)

Product name	PTX25517-100
Uniprot ID	P78556
Raw Antigen Sequence	MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-CCL20, Anti-MIP-3-alpha, GSK3050002
Isotype	IgG
Clonality	Monoclonal Antibody
Protein Name	CCL20

Product name	PTX25517-1MG
Uniprot ID	P78556
Raw Antigen Sequence	MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-CCL20, Anti-MIP-3-alpha, GSK3050002
Isotype	IgG
Clonality	Monoclonal Antibody
Protein Name	CCL20

Product name	PTX25517-50
Uniprot ID	P78556
Raw Antigen Sequence	MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-CCL20, Anti-MIP-3-alpha, GSK3050002
Isotype	IgG
Clonality	Monoclonal Antibody
Protein Name	CCL20

Datasheet

There are no reviews yet.

Be the first to review “Anti-Human CCL20/MIP-3-alpha (GSK3050002)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Human CCL20/MIP-3-alpha (GSK3050002)

Anti-Human CCL20/MIP-3-alpha (GSK3050002)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human CCL20/MIP-3-alpha (GSK3050002)

Specifications Anti-Human CCL20/MIP-3-alpha (GSK3050002)

Documents

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human CCL20/MIP-3-alpha (GSK3050002)