Brand: ProteoGenix

Anti-Human CCL4L1 Polyclonal Antibody

ARO-A11708-100
Validated WB

Clonality:: Polyclonal Antibody
Host species:: Rabbit

Original price was: $280.00.Current price is: $201.00.

100ug 28% OFF + 201 loyalty points

Size Size

50ug Original price was: $174.00.Current price is: $140.00.
100ug Original price was: $280.00.Current price is: $201.00.
1MG Original price was: $764.00.Current price is: $583.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human CCL4L1 Polyclonal Antibody

Product name	ARO-A11708-100
Uniprot ID	Q8NHW4
Raw Antigen Sequence	APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-MIP-1-beta, CCL4L, SCYA4L2, Monocyte adherence-induced protein 5-alpha, CCL4L1, Lymphocyte activation gene 1 protein, LAG-1, SCYA4L1, Macrophage inflammatory protein 1-beta, Small-inducible cytokine A4-like, LAG1, C-C motif chemokine 4-like
Reference	ARO-A11708
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human CCL4L1 (Ala24-Asn92).

Product name	ARO-A11708-1MG
Uniprot ID	Q8NHW4
Raw Antigen Sequence	APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-MIP-1-beta, CCL4L, SCYA4L2, Monocyte adherence-induced protein 5-alpha, CCL4L1, Lymphocyte activation gene 1 protein, LAG-1, SCYA4L1, Macrophage inflammatory protein 1-beta, Small-inducible cytokine A4-like, LAG1, C-C motif chemokine 4-like
Reference	ARO-A11708
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human CCL4L1 (Ala24-Asn92).

Product name	ARO-A11708-50
Uniprot ID	Q8NHW4
Raw Antigen Sequence	APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-MIP-1-beta, CCL4L, SCYA4L2, Monocyte adherence-induced protein 5-alpha, CCL4L1, Lymphocyte activation gene 1 protein, LAG-1, SCYA4L1, Macrophage inflammatory protein 1-beta, Small-inducible cytokine A4-like, LAG1, C-C motif chemokine 4-like
Reference	ARO-A11708
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human CCL4L1 (Ala24-Asn92).

Datasheet

Anti-Human CCL4L1 Polyclonal Antibody binds to CCL4L1, N-GST, recombinant protein in WB Assay

CCL4L1, N-GST, recombinant protein(cat. No.PX-P5546) can bind Anti-Human CCL4L1 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Human CCL4L1 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Human CCL4L1 Polyclonal Antibody

Anti-Human CCL4L1 Polyclonal Antibody

Anti-Human CCL4L1 Polyclonal Antibody binds to CCL4L1, N-GST, recombinant protein in WB Assay

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human CCL4L1 Polyclonal Antibody

Specifications Anti-Human CCL4L1 Polyclonal Antibody

Documents

QC & Validation

Anti-Human CCL4L1 Polyclonal Antibody binds to CCL4L1, N-GST, recombinant protein in WB Assay

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human CCL4L1 Polyclonal Antibody