Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human CD16b/FCGR3B Antibody (B88-9), PE

  • ARO-A10727-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG1, kappa
Clone Name:
B88-9

Original price was: $527.00.Current price is: $421.00.

50ug 20% OFF + 421 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Anti-Human CD16b/FCGR3B Antibody (B88-9), PE

Anti-Human CD16b/FCGR3B Antibody (B88-9), PE

Product name ARO-A10727-100
Uniprot ID O75015
Raw Antigen Sequence MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Reference ARO-A10727
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Clone Name B88-9
Product name ARO-A10727-1MG
Uniprot ID O75015
Raw Antigen Sequence MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Reference ARO-A10727
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Clone Name B88-9
Product name ARO-A10727-50
Uniprot ID O75015
Raw Antigen Sequence MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Reference ARO-A10727
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Clone Name B88-9

Flow Cytometry results for Anti-Human CD16b/FCGR3B Antibody (B88-9), PE

Flow Cytometry results for Anti-Human CD16b/FCGR3B Antibody (B88-9), PE

Flow-cytometry PE using anti-human CD16A antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an PE anti-human CD16A monoclonal antibody (Catalog ARO-A10727) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CD16b/FCGR3B Antibody (B88-9), PE”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products