Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human CD300f/CD300LF Antibody (ABS0483)

Clonality:
Monoclonal Antibody
Isotype:
IgG2a, kappa

Original price was: $587.00.Current price is: $451.00.

100ug 23% OFF + 451 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Human CD300f/CD300LF Antibody (ABS0483)

Anti-Human CD300f/CD300LF Antibody (ABS0483)

Product name ARO-A17514-100
Uniprot ID Q8TDQ1
Raw Antigen Sequence MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRMMKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEEPTEYSTISRP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CD300f, Anti-CD300LF
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name CD300f
Product name ARO-A17514-1MG
Uniprot ID Q8TDQ1
Raw Antigen Sequence MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRMMKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEEPTEYSTISRP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CD300f, Anti-CD300LF
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name CD300f
Product name ARO-A17514-50
Uniprot ID Q8TDQ1
Raw Antigen Sequence MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRMMKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEEPTEYSTISRP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CD300f, Anti-CD300LF
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name CD300f

SDS-PAGE for Anti-Human CD300f/CD300LF Antibody (ABS0483)

SDS-PAGE for Anti-Human CD300f/CD300LF Antibody (ABS0483)

Anti-Human CD300f/CD300LF Antibody (ABS0483), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Human CD300f/CD300LF Antibody (ABS0483)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products