Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD335/NCR1/NKp46 Antibody (8E5#), FITC

Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG2a, kappa
Clone Name:
8E5#

Original price was: $437.00.Current price is: $324.00.

50ug 26% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD335/NCR1/NKp46 Antibody (8E5#), FITC

Product name ARO-A10958-100
Uniprot ID O76036
Raw Antigen Sequence MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference ARO-A10958
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Clone Name 8E5#
Product name ARO-A10958-1MG
Uniprot ID O76036
Raw Antigen Sequence MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference ARO-A10958
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Clone Name 8E5#
Product name ARO-A10958-50
Uniprot ID O76036
Raw Antigen Sequence MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference ARO-A10958
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Clone Name 8E5#

There are no reviews yet.

Be the first to review “Anti-Human CD335/NCR1/NKp46 Antibody (8E5#), FITC”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products