Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CLDN5/Claudin-5 Antibody (M11), APC

Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG2a, kappa
Target species:
Human, Monkey
Clone Name:
M11

Original price was: $527.00.Current price is: $421.00.

50ug 20% OFF + 421 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CLDN5/Claudin-5 Antibody (M11), APC

Product name ARO-A10494-100
Uniprot ID O00501
Raw Antigen Sequence MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-A10494
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Clone Name M11
Target species Human, Monkey
Product name ARO-A10494-1MG
Uniprot ID O00501
Raw Antigen Sequence MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-A10494
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Clone Name M11
Target species Human, Monkey
Product name ARO-A10494-50
Uniprot ID O00501
Raw Antigen Sequence MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-A10494
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Clone Name M11
Target species Human, Monkey

There are no reviews yet.

Be the first to review “Anti-Human CLDN5/Claudin-5 Antibody (M11), APC”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products