Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CTAG1A/NY-ESO-1/LAGE-2 Antibody (ABS0004)

Clonality:
Monoclonal Antibody
Isotype:
IgG2a, kappa

Original price was: $270.00.Current price is: $214.00.

100ug 21% OFF + 214 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CTAG1A/NY-ESO-1/LAGE-2 Antibody (ABS0004)

Product name ARO-A17497-100
Uniprot ID P78358
Raw Antigen Sequence MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CTAG1A, Anti-NY-ESO-1, Anti-LAGE-2
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name CTAG1A
Product name ARO-A17497-1MG
Uniprot ID P78358
Raw Antigen Sequence MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CTAG1A, Anti-NY-ESO-1, Anti-LAGE-2
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name CTAG1A
Product name ARO-A17497-50
Uniprot ID P78358
Raw Antigen Sequence MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CTAG1A, Anti-NY-ESO-1, Anti-LAGE-2
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name CTAG1A

There are no reviews yet.

Be the first to review “Anti-Human CTAG1A/NY-ESO-1/LAGE-2 Antibody (ABS0004)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products