Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CTAG1A/NY-ESO-1/LAGE-2 Recombinant Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P78358

Original price was: $328.00.Current price is: $271.00.

50ug 17% OFF + 271 loyalty points
GST Ser85–Arg180 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CTAG1A/NY-ESO-1/LAGE-2 Recombinant Protein, N-GST & C-His

Product name ARO-P18880-100
Uniprot ID P78358
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser85-Arg180
Aliases /Synonyms Autoimmunogenic cancer/testis antigen NY-ESO-1, CT6.1, CTAG, CTAG1, CTAG1A, Cancer/testis antigen 1, Cancer/testis antigen 6.1, ESO1, L antigen family member 2, LAGE-2, LAGE2, LAGE2A
Reference ARO-P18880
Note For research use only.
Molecular Constructor
GST Ser85–Arg180 His
Product name ARO-P18880-1MG
Uniprot ID P78358
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser85-Arg180
Aliases /Synonyms Autoimmunogenic cancer/testis antigen NY-ESO-1, CT6.1, CTAG, CTAG1, CTAG1A, Cancer/testis antigen 1, Cancer/testis antigen 6.1, ESO1, L antigen family member 2, LAGE-2, LAGE2, LAGE2A
Reference ARO-P18880
Note For research use only.
Molecular Constructor
GST Ser85–Arg180 His
Product name ARO-P18880-50
Uniprot ID P78358
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser85-Arg180
Aliases /Synonyms Autoimmunogenic cancer/testis antigen NY-ESO-1, CT6.1, CTAG, CTAG1, CTAG1A, Cancer/testis antigen 1, Cancer/testis antigen 6.1, ESO1, L antigen family member 2, LAGE-2, LAGE2, LAGE2A
Reference ARO-P18880
Note For research use only.
Molecular Constructor
GST Ser85–Arg180 His

There are no reviews yet.

Be the first to review “Human CTAG1A/NY-ESO-1/LAGE-2 Recombinant Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products