Brand: ProteoGenix

Anti-Human CTSB Monoclonal Antibody (2A2)

PTX25184-50
Validated FC WB

Clonality:: Monoclonal Antibody
Isotype:: IgG2a, kappa

Original price was: $432.00.Current price is: $315.00.

50ug 27% OFF + 315 loyalty points

Size Size

50ug Original price was: $432.00.Current price is: $315.00.
100ug Original price was: $546.00.Current price is: $451.00.
1MG Original price was: $1,661.00.Current price is: $1,308.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Anti-Human CTSB Monoclonal Antibody (2A2) binds to Human CTSB Recombinant Protein, C-His in WB Assay

SDS-PAGE for Anti-Human CTSB Monoclonal Antibody (2A2)

Datasheet

Anti-Human CTSB Monoclonal Antibody (2A2)

Product name	PTX25184-100
Uniprot ID	P07858
Raw Antigen Sequence	MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-CTSB
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Protein Name	CTSB

Product name	PTX25184-1MG
Uniprot ID	P07858
Raw Antigen Sequence	MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-CTSB
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Protein Name	CTSB

Product name	PTX25184-50
Uniprot ID	P07858
Raw Antigen Sequence	MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-CTSB
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Protein Name	CTSB

Datasheet

Anti-Human CTSB Monoclonal Antibody (2A2) binds to Human CTSB Recombinant Protein, C-His in WB Assay

Human CTSB Recombinant Protein, C-His(cat. No.ARO-P18128) can bind Anti-Human CTSB Monoclonal Antibody (2A2) in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Anti-Human CTSB Monoclonal Antibody (2A2)

Anti-Human CTSB Monoclonal Antibody (2A2), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Anti-Human CTSB Monoclonal Antibody (2A2)

Flow-cytometry using FITC anti-human CTSB antibody. HepG-2 cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human CTSB monoclonal antibody (Catalog: PTX25184, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CTSB Monoclonal Antibody (2A2)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Human CTSB Monoclonal Antibody (2A2)

Anti-Human CTSB Monoclonal Antibody (2A2)

Anti-Human CTSB Monoclonal Antibody (2A2) binds to Human CTSB Recombinant Protein, C-His in WB Assay

SDS-PAGE for Anti-Human CTSB Monoclonal Antibody (2A2)

Flow Cytometry results for Anti-Human CTSB Monoclonal Antibody (2A2)

Related products

Human CTSB Recombinant Protein, C-His

Anti-CTSB Polyclonal Antibody

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human CTSB Monoclonal Antibody (2A2)

Specifications Anti-Human CTSB Monoclonal Antibody (2A2)

Documents

QC & Validation

Anti-Human CTSB Monoclonal Antibody (2A2) binds to Human CTSB Recombinant Protein, C-His in WB Assay

SDS-PAGE for Anti-Human CTSB Monoclonal Antibody (2A2)

Flow Cytometry results for Anti-Human CTSB Monoclonal Antibody (2A2)

Reviews

Related products

Human CTSB Recombinant Protein, C-His

Anti-CTSB Polyclonal Antibody

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human CTSB Monoclonal Antibody (2A2)