Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CXCL12/SDF-1 Antibody (SAA0467)

  • ARO-A15487-50
  • Validated ELISA FC

Original price was: $350.00.Current price is: $284.00.

50ug 19% OFF + 284 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CXCL12/SDF-1 Antibody (SAA0467)

Product name ARO-A15487-100
Uniprot ID P48061
Raw Antigen Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15487
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CXCL12/SDF-1
Clone Name SAA0467
Protein Name CXCL12/SDF-1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15487-1MG
Uniprot ID P48061
Raw Antigen Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15487
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CXCL12/SDF-1
Clone Name SAA0467
Protein Name CXCL12/SDF-1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15487-50
Uniprot ID P48061
Raw Antigen Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15487
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CXCL12/SDF-1
Clone Name SAA0467
Protein Name CXCL12/SDF-1
Target species Anti-Human Monoclonal Antibody

Anti-Human CXCL12/SDF-1 Antibody (SAA0467) binds to Stromal cell-derived factor 1(CXCL12) in ELISA Assay

Anti-Human CXCL12/SDF-1 Antibody (SAA0467) binds to Stromal cell-derived factor 1(CXCL12) in ELISA Assay

Stromal cell-derived factor 1(CXCL12)(cat. No.PX-P4857) at 0.5µg/mL (100µL/well) can bind Anti-Human CXCL12/SDF-1 Antibody (SAA0467) in indirect ELISA with Goat secondary antibody measured by OD450.

Flow Cytometry results for Anti-Human CXCL12/SDF-1 Antibody (SAA0467)

Flow Cytometry results for Anti-Human CXCL12/SDF-1 Antibody (SAA0467)

Flow-cytometry using anti-human CXCL12 antibody.MDA-MB-453 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human CXCL12 antibody monoclonal antibody (Catalog # ARO-A15487 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human CXCL12/SDF-1 Antibody (SAA0467)

There are no reviews yet.

Be the first to review “Anti-Human CXCL12/SDF-1 Antibody (SAA0467)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products