Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Stromal cell-derived factor 1(CXCL12)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P48061
Molecular weight:
8.1kDa

$217.00

50ug + 217 loyalty points
Lys22–Lys89 No
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Stromal cell-derived factor 1(CXCL12)

Stromal cell-derived factor 1(CXCL12)

Product name Stromal cell-derived factor 1(CXCL12)
Uniprot ID P48061
Uniprot link https://www.uniprot.org/uniprot/P48061
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Molecular weight 8.1kDa
Protein delivered with Tag? No tag
Purity estimated >90% by SDS-PAGE
Buffer PBS，pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Lys89
Protein Accession P48061
Spec:Entrez GeneID 6387
Spec:NCBI Gene Aliases IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12
Spec:SwissProtID Q6ICW0
NCBI Reference P48061
Aliases /Synonyms SDF-1,hSDF-1,C-X-C motif chemokine 12,Intercrine reduced in hepatomas,IRH,hIRH,Pre-B cell growth-stimulating factor,PBSF,SDF1, SDF1A, SDF1B
Reference PX-P4857
Note For research use only
Molecular Constructor
Lys22–Lys89 No
Product name Stromal cell-derived factor 1(CXCL12)
Uniprot ID P48061
Uniprot link https://www.uniprot.org/uniprot/P48061
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Molecular weight 8.1kDa
Protein delivered with Tag? No tag
Purity estimated >90% by SDS-PAGE
Buffer PBS，pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Lys89
Protein Accession P48061
Spec:Entrez GeneID 6387
Spec:NCBI Gene Aliases IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12
Spec:SwissProtID Q6ICW0
NCBI Reference P48061
Aliases /Synonyms SDF-1,hSDF-1,C-X-C motif chemokine 12,Intercrine reduced in hepatomas,IRH,hIRH,Pre-B cell growth-stimulating factor,PBSF,SDF1, SDF1A, SDF1B
Reference PX-P4857
Note For research use only
Molecular Constructor
Lys22–Lys89 No

There are no reviews yet.

Be the first to review “Stromal cell-derived factor 1(CXCL12)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products