Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CXCL12/SDF-1 VHH (SAA1273)

Note:
For research use only. Not suitable for human use.

Original price was: $380.00.Current price is: $317.00.

50ug 17% OFF + 317 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CXCL12/SDF-1 VHH (SAA1273)

Product name ARO-A16407-100
Uniprot ID P48061
Raw Antigen Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Intercrine reduced in hepatomas, anti-hSDF-1, anti-Stromal cell-derived factor 1, anti-SDF-1, anti-Pre-B cell growth-stimulating factor, anti-SDF1, anti-SDF1A, anti-C-X-C motif chemokine 12, anti-SDF1B, anti-CXCL12, anti-IRH, anti-PBSF, anti-hIRH
Reference ARO-A16407
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CXCL12/SDF-1
Clone Name SAA1273
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16407-1MG
Uniprot ID P48061
Raw Antigen Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Intercrine reduced in hepatomas, anti-hSDF-1, anti-Stromal cell-derived factor 1, anti-SDF-1, anti-Pre-B cell growth-stimulating factor, anti-SDF1, anti-SDF1A, anti-C-X-C motif chemokine 12, anti-SDF1B, anti-CXCL12, anti-IRH, anti-PBSF, anti-hIRH
Reference ARO-A16407
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CXCL12/SDF-1
Clone Name SAA1273
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16407-50
Uniprot ID P48061
Raw Antigen Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Intercrine reduced in hepatomas, anti-hSDF-1, anti-Stromal cell-derived factor 1, anti-SDF-1, anti-Pre-B cell growth-stimulating factor, anti-SDF1, anti-SDF1A, anti-C-X-C motif chemokine 12, anti-SDF1B, anti-CXCL12, anti-IRH, anti-PBSF, anti-hIRH
Reference ARO-A16407
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CXCL12/SDF-1
Clone Name SAA1273
Target species Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

Anti-Human CXCL12/SDF-1 VHH (SAA1273)

There are no reviews yet.

Be the first to review “Anti-Human CXCL12/SDF-1 VHH (SAA1273)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products