Brand: ProteoGenix

Anti-Human CXCL9/MIG Antibody (SAA0465)

ARO-A15481-100
Quality Chart

Original price was: $509.00.Current price is: $407.00.

100ug 20% OFF + 407 loyalty points

Size Size

50ug Original price was: $342.00.Current price is: $284.00.
100ug Original price was: $509.00.Current price is: $407.00.
1MG Original price was: $1,428.00.Current price is: $1,180.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Anti-Human CXCL9/MIG Antibody (SAA0465)

Datasheet

Anti-Human CXCL9/MIG Antibody (SAA0465)

Product name	ARO-A15481-100
Uniprot ID	Q07325
Raw Antigen Sequence	MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15481
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CXCL9/MIG
Clone Name	SAA0465
Protein Name	CXCL9/MIG
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15481-1MG
Uniprot ID	Q07325
Raw Antigen Sequence	MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15481
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CXCL9/MIG
Clone Name	SAA0465
Protein Name	CXCL9/MIG
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15481-50
Uniprot ID	Q07325
Raw Antigen Sequence	MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15481
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CXCL9/MIG
Clone Name	SAA0465
Protein Name	CXCL9/MIG
Target species	Anti-Human Monoclonal Antibody

Datasheet

SDS-PAGE for Anti-Human CXCL9/MIG Antibody (SAA0465)

Anti-Human CXCL9/MIG Antibody (SAA0465), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Human CXCL9/MIG Antibody (SAA0465)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Human CXCL9/MIG Antibody (SAA0465)

Anti-Human CXCL9/MIG Antibody (SAA0465)

SDS-PAGE for Anti-Human CXCL9/MIG Antibody (SAA0465)

Related products

Rat IgG2a, kappa Isotype Control Antibody (RTK2758), PerCP

CXCL9 / MIG Polyclonal Antibody

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human CXCL9/MIG Antibody (SAA0465)

Specifications Anti-Human CXCL9/MIG Antibody (SAA0465)

Documents

QC & Validation

SDS-PAGE for Anti-Human CXCL9/MIG Antibody (SAA0465)

3D Representation

Reviews

Related products

Rat IgG2a, kappa Isotype Control Antibody (RTK2758), PerCP

CXCL9 / MIG Polyclonal Antibody

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human CXCL9/MIG Antibody (SAA0465)