Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human H3K9ac Antibody (SAA0502)

Original price was: $444.00.Current price is: $324.00.

50ug 27% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human H3K9ac Antibody (SAA0502)

Product name ARO-A14897-100
Uniprot ID P68431
Raw Antigen Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14897
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Histone H3/j, Histone H3/b, Histone H3/d, Histone H3/c, HIST1H3B, H3FH, Histone H3/f, H3FF, H3FK, HIST1H3G, H3FL, H3FB, HIST1H3D, Histone H3/a, H3FI, Histone H3/i, H3FD, HIST1H3A, Histone H3/h, HIST1H3I, HIST1H3E, HIST1H3H, HIST1H3J, H3C1, H3FC HIST1H3C, H3FA, Histone H3.1, H3FJ, Histone H3/l, Histone H3/k, HIST1H3F
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14897-1MG
Uniprot ID P68431
Raw Antigen Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14897
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Histone H3/j, Histone H3/b, Histone H3/d, Histone H3/c, HIST1H3B, H3FH, Histone H3/f, H3FF, H3FK, HIST1H3G, H3FL, H3FB, HIST1H3D, Histone H3/a, H3FI, Histone H3/i, H3FD, HIST1H3A, Histone H3/h, HIST1H3I, HIST1H3E, HIST1H3H, HIST1H3J, H3C1, H3FC HIST1H3C, H3FA, Histone H3.1, H3FJ, Histone H3/l, Histone H3/k, HIST1H3F
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14897-50
Uniprot ID P68431
Raw Antigen Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14897
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Histone H3/j, Histone H3/b, Histone H3/d, Histone H3/c, HIST1H3B, H3FH, Histone H3/f, H3FF, H3FK, HIST1H3G, H3FL, H3FB, HIST1H3D, Histone H3/a, H3FI, Histone H3/i, H3FD, HIST1H3A, Histone H3/h, HIST1H3I, HIST1H3E, HIST1H3H, HIST1H3J, H3C1, H3FC HIST1H3C, H3FA, Histone H3.1, H3FJ, Histone H3/l, Histone H3/k, HIST1H3F
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human H3K9ac Antibody (SAA0502)

SDS-PAGE for Anti-Human H3K9ac Antibody (SAA0502)

Anti-Human H3K9ac Antibody (SAA0502), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human H3K9ac Antibody (SAA0502)

There are no reviews yet.

Be the first to review “Anti-Human H3K9ac Antibody (SAA0502)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products