Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394)

Original price was: $570.00.Current price is: $407.00.

100ug 29% OFF + 407 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394)
Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394)

Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394)

Product name ARO-A15566-100
Uniprot ID Q8IZI9
Raw Antigen Sequence MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15566
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen IL28B/IL28C/IFNL3
Clone Name SAA0394
Protein Name IL28B/IL28C/IFNL3
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15566-1MG
Uniprot ID Q8IZI9
Raw Antigen Sequence MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15566
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen IL28B/IL28C/IFNL3
Clone Name SAA0394
Protein Name IL28B/IL28C/IFNL3
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15566-50
Uniprot ID Q8IZI9
Raw Antigen Sequence MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15566
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen IL28B/IL28C/IFNL3
Clone Name SAA0394
Protein Name IL28B/IL28C/IFNL3
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394)

SDS-PAGE for Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394)

Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394)

There are no reviews yet.

Be the first to review “Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products