Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human IL36A/IL-1F6 Antibody (SAA0397)

Original price was: $370.00.Current price is: $284.00.

50ug 23% OFF + 284 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human IL36A/IL-1F6 Antibody (SAA0397)

Product name ARO-A15575-100
Uniprot ID Q9UHA7
Raw Antigen Sequence MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15575
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen IL36A/IL-1F6
Clone Name SAA0397
Protein Name IL36A/IL-1F6
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15575-1MG
Uniprot ID Q9UHA7
Raw Antigen Sequence MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15575
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen IL36A/IL-1F6
Clone Name SAA0397
Protein Name IL36A/IL-1F6
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15575-50
Uniprot ID Q9UHA7
Raw Antigen Sequence MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15575
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen IL36A/IL-1F6
Clone Name SAA0397
Protein Name IL36A/IL-1F6
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human IL36A/IL-1F6 Antibody (SAA0397)

SDS-PAGE for Anti-Human IL36A/IL-1F6 Antibody (SAA0397)

Anti-Human IL36A/IL-1F6 Antibody (SAA0397), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human IL36A/IL-1F6 Antibody (SAA0397)

There are no reviews yet.

Be the first to review “Anti-Human IL36A/IL-1F6 Antibody (SAA0397)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products