Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL36A/IL-1F6, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UHA7
Molecular weight:
19.85 kDa

Original price was: $318.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
Met1–Phe158
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL36A/IL-1F6, N-His

Product name ARO-P13032-100
Uniprot ID Q9UHA7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Molecular weight 19.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe158
Aliases /Synonyms IL1F6, IL-1 epsilon, IL1E, IL36A, Interleukin-1 family member 6, FIL1 epsilon, FIL1E, IL-1F6, Interleukin-36 alpha, Interleukin-1 epsilon
Reference ARO-P13032
Note For research use only.
Molecular Constructor
Met1–Phe158
Product name ARO-P13032-1MG
Uniprot ID Q9UHA7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Molecular weight 19.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe158
Aliases /Synonyms IL1F6, IL-1 epsilon, IL1E, IL36A, Interleukin-1 family member 6, FIL1 epsilon, FIL1E, IL-1F6, Interleukin-36 alpha, Interleukin-1 epsilon
Reference ARO-P13032
Note For research use only.
Molecular Constructor
Met1–Phe158
Product name ARO-P13032-50
Uniprot ID Q9UHA7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Molecular weight 19.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe158
Aliases /Synonyms IL1F6, IL-1 epsilon, IL1E, IL36A, Interleukin-1 family member 6, FIL1 epsilon, FIL1E, IL-1F6, Interleukin-36 alpha, Interleukin-1 epsilon
Reference ARO-P13032
Note For research use only.
Molecular Constructor
Met1–Phe158

Introduction

Recombinant Human IL36A, also known as IL-1F6, is a cytokine protein that belongs to the interleukin-1 (IL-1) family. It is encoded by the IL36A gene and is expressed by various immune cells, including monocytes, macrophages, and dendritic cells. IL36A is involved in the regulation of inflammatory and immune responses, making it a crucial protein in the body’s defense against pathogens and diseases.

Structure of Recombinant Human IL36A

Recombinant Human IL36A is a 17-kDa protein consisting of 159 amino acids. It has a typical IL-1 family cytokine structure, with a central beta-trefoil domain and an N-terminal alpha-helical domain. The beta-trefoil domain is responsible for binding to the IL-36 receptor (IL-36R), while the N-terminal domain is involved in receptor activation.

Activity of Recombinant Human IL36A

Recombinant Human IL36A is a pro-inflammatory cytokine that plays a crucial role in the body’s immune response. It acts as an agonist for the IL-36R, a receptor that is expressed on various immune cells. Upon binding to the receptor, IL36A triggers a signaling cascade that leads to the activation of nuclear factor kappa B (NF-κB) and mitogen-activated protein kinases (MAPKs). This results in the production of pro-inflammatory cytokines, chemokines, and other immune mediators, leading to an inflammatory response.

IL36A is also involved in the recruitment and activation of immune cells, such as neutrophils, monocytes, and T cells, at the site of infection or injury. It also plays a role in the differentiation and maturation of dendritic cells, which are responsible for presenting antigens to T cells and initiating an immune response. Furthermore, IL36A can induce the production of antimicrobial peptides, enhancing the body’s defense against pathogens.

Application of Recombinant Human IL36A

Recombinant Human IL36A has various applications in both research and clinical settings. It is commonly used as a recombinant protein for in vitro studies to investigate its role in inflammatory and immune responses. Its activity can be measured by assessing the production of pro-inflammatory cytokines and chemokines in cell culture systems.

In addition, recombinant IL36A has potential therapeutic applications. It has been shown to have anti-tumor activity in certain types of cancer, making it a potential candidate for cancer immunotherapy. IL36A has also been implicated in various inflammatory diseases, such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease. Therefore, targeting IL36A with recombinant protein or antibodies may have therapeutic benefits in these conditions.

Another potential application of recombinant IL36A is in vaccine development. IL36A is a potent activator of dendritic cells, which are crucial for initiating an immune response against vaccines. Therefore, incorporating recombinant IL36A in vaccine formulations may enhance their efficacy and stimulate a stronger immune response.

Conclusion

In summary, Recombinant Human IL36A is a pro-inflammatory cytokine that plays a crucial role in the body’s immune response. It has a typical IL-1 family cytokine structure and activates the IL-36 receptor to induce an inflammatory response. Its activity and potential therapeutic applications make it a valuable protein in both research and clinical settings. Further studies on IL36A and its interactions with other immune mediators may lead to the development of novel treatments for various inflammatory and immune-related diseases.

Recombinant Human IL36A/IL-1F6, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IL36A/IL-1F6, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products