Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IRS2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y4H2
Molecular weight:
25.36 kDa

Original price was: $269.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Gly185–Arg301
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IRS2 Protein, N-His-SUMO

Product name ARO-P11344-100
Uniprot ID Q9Y4H2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFR
Molecular weight 25.36 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Arg301
Aliases /Synonyms IRS2, Insulin receptor substrate 2, IRS-2
Reference ARO-P11344
Note For research use only.
Molecular Constructor
Gly185–Arg301
Product name ARO-P11344-1MG
Uniprot ID Q9Y4H2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFR
Molecular weight 25.36 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Arg301
Aliases /Synonyms IRS2, Insulin receptor substrate 2, IRS-2
Reference ARO-P11344
Note For research use only.
Molecular Constructor
Gly185–Arg301
Product name ARO-P11344-50
Uniprot ID Q9Y4H2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFR
Molecular weight 25.36 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Arg301
Aliases /Synonyms IRS2, Insulin receptor substrate 2, IRS-2
Reference ARO-P11344
Note For research use only.
Molecular Constructor
Gly185–Arg301

Introduction to Recombinant Human IRS2 Protein

Recombinant Human IRS2 Protein is a genetically engineered protein that is produced in the laboratory using recombinant DNA technology. This protein is a member of the insulin receptor substrate (IRS) family and plays a crucial role in insulin signaling and glucose metabolism. It is encoded by the IRS2 gene and is found in various tissues including the liver, muscle, and adipose tissue.

Structure of Recombinant Human IRS2 Protein

The recombinant human IRS2 protein is a 133 kDa protein consisting of 1334 amino acids. It contains several functional domains, including the pleckstrin homology (PH) domain, the phosphotyrosine-binding (PTB) domain, and the phosphotyrosine interaction (PI) domain. These domains are responsible for the protein’s interaction with other molecules involved in insulin signaling.

The PH domain is located at the N-terminus of the protein and is responsible for binding to phosphoinositides, which are important signaling molecules in insulin signaling pathways. The PTB domain is located in the middle of the protein and is responsible for binding to the insulin receptor. The PI domain is located at the C-terminus and is responsible for binding to other signaling molecules, such as SH2 domain-containing proteins.

Activity of Recombinant Human IRS2 Protein

The primary function of Recombinant Human IRS2 Protein is to transmit signals from the insulin receptor to downstream signaling molecules. Upon binding to the insulin receptor, the PTB domain of IRS2 becomes phosphorylated, which leads to the recruitment of other signaling molecules, such as PI3-kinase and Grb2. These molecules then activate downstream signaling pathways, such as the Akt and MAPK pathways, which play crucial roles in glucose metabolism and cell growth.

In addition to insulin signaling, Recombinant Human IRS2 Protein also plays a role in other biological processes, such as cell survival, proliferation, and differentiation. It has been shown to be involved in the regulation of gene expression and the maintenance of cellular homeostasis.

Application of Recombinant Human IRS2 Protein

Recombinant Human IRS2 Protein has various applications in both research and therapeutic settings. In research, it is commonly used as a tool to study insulin signaling and glucose metabolism. Its recombinant nature allows for large-scale production, making it easily accessible for researchers to use in their experiments.

In therapeutic settings, Recombinant Human IRS2 Protein has potential applications in the treatment of diseases related to insulin resistance, such as type 2 diabetes. Studies have shown that mutations in the IRS2 gene are associated with insulin resistance and type 2 diabetes. By understanding the structure and function of this protein, researchers can develop targeted therapies to improve insulin sensitivity and glucose metabolism in patients with these conditions.

Conclusion

In summary, Recombinant Human IRS2 Protein is a crucial component of insulin signaling and plays a significant role in glucose metabolism and other biological processes. Its structure and function have been extensively studied, and it has various applications in both research and therapeutic settings. Further research on this protein may lead to a better understanding of insulin resistance and the development of more effective treatments for related diseases.

Recombinant Human IRS2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human IRS2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products