Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human ILF3 Polyclonal Antibody

  • ARO-A13499-100
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: $282.00.Current price is: $201.00.

100ug 29% OFF + 201 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human ILF3 Polyclonal Antibody binds to Recombinant Human ILF3, N-His in WB Assay
Anti-Human ILF3 Polyclonal Antibody

Anti-Human ILF3 Polyclonal Antibody

Product name ARO-A13499-100
Uniprot ID Q12906
Raw Antigen Sequence YGSYGYGGNSATAGYSQFYSNGGHSGNASGGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQGKQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNY
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-ILF3, MPHOSPH4, DRBP76, TCP80, DRBF, Translational control protein 80, M-phase phosphoprotein 4, Nuclear factor associated with dsRNA, NF90, NFAR, MPP4, NF-AT-90, Double-stranded RNA-binding protein 76, Interleukin enhancer-binding factor 3, Nuclear factor of activated T-cells 90 kDa
Reference ARO-A13499
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human ILF3 (Tyr672-Tyr891).
Product name ARO-A13499-1MG
Uniprot ID Q12906
Raw Antigen Sequence YGSYGYGGNSATAGYSQFYSNGGHSGNASGGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQGKQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNY
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-ILF3, MPHOSPH4, DRBP76, TCP80, DRBF, Translational control protein 80, M-phase phosphoprotein 4, Nuclear factor associated with dsRNA, NF90, NFAR, MPP4, NF-AT-90, Double-stranded RNA-binding protein 76, Interleukin enhancer-binding factor 3, Nuclear factor of activated T-cells 90 kDa
Reference ARO-A13499
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human ILF3 (Tyr672-Tyr891).
Product name ARO-A13499-50
Uniprot ID Q12906
Raw Antigen Sequence YGSYGYGGNSATAGYSQFYSNGGHSGNASGGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQGKQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNY
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-ILF3, MPHOSPH4, DRBP76, TCP80, DRBF, Translational control protein 80, M-phase phosphoprotein 4, Nuclear factor associated with dsRNA, NF90, NFAR, MPP4, NF-AT-90, Double-stranded RNA-binding protein 76, Interleukin enhancer-binding factor 3, Nuclear factor of activated T-cells 90 kDa
Reference ARO-A13499
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human ILF3 (Tyr672-Tyr891).

Anti-Human ILF3 Polyclonal Antibody binds to Recombinant Human ILF3, N-His in WB Assay

Anti-Human ILF3 Polyclonal Antibody binds to Recombinant Human ILF3, N-His in WB Assay

Recombinant Human ILF3, N-His(cat. No.ARO-P12864) can bind Anti-Human ILF3 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Anti-Human ILF3 Polyclonal Antibody

There are no reviews yet.

Be the first to review “Anti-Human ILF3 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products