Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

  • ARO-A15482-50
  • Validated FC

Original price was: $397.00.Current price is: $326.00.

50ug 18% OFF + 326 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

Product name ARO-A15482-100
Uniprot ID Q96E93
Raw Antigen Sequence MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15482
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen KLRG1/CLEC15A
Clone Name SAA0508
Protein Name KLRG1/CLEC15A
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15482-1MG
Uniprot ID Q96E93
Raw Antigen Sequence MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15482
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen KLRG1/CLEC15A
Clone Name SAA0508
Protein Name KLRG1/CLEC15A
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15482-50
Uniprot ID Q96E93
Raw Antigen Sequence MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15482
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen KLRG1/CLEC15A
Clone Name SAA0508
Protein Name KLRG1/CLEC15A
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

Flow Cytometry results for Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

Flow-cytometry using anti-human KLRG1 antibody.Human peripheral blood lymphocytes were stained with an irrelevant antibody (Blue Histogram) or an anti-human KLRG1 antibody monoclonal antibody (Catalog # ARO-A15482 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

SDS-PAGE for Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

Anti-Human KLRG1/CLEC15A Antibody (SAA0508), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

There are no reviews yet.

Be the first to review “Anti-Human KLRG1/CLEC15A Antibody (SAA0508)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products