Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human PDGFB Antibody (SAA0449), FITC

  • ARO-A10939-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG2a, kappa
Clone Name:
SAA0449

Original price was: $394.00.Current price is: $283.00.

50ug 28% OFF + 283 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Anti-Human PDGFB Antibody (SAA0449), FITC

Anti-Human PDGFB Antibody (SAA0449), FITC

Product name ARO-A10939-100
Uniprot ID P01127
Raw Antigen Sequence MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-PDGF-2, Proto-oncogene c-Sis, PDGF2, SIS, Platelet-derived growth factor B chain, PDGFB, Becaplermin, Platelet-derived growth factor beta polypeptide, Platelet-derived growth factor subunit B, PDGF subunit B
Reference ARO-A10939
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target PDGF-2, Proto-oncogene c-Sis, PDGF2, SIS, Platelet-derived growth factor B chain, PDGFB, Becaplermin, Platelet-derived growth factor beta polypeptide, Platelet-derived growth factor subunit B, PDGF subunit B
Clone Name SAA0449
Product name ARO-A10939-1MG
Uniprot ID P01127
Raw Antigen Sequence MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-PDGF-2, Proto-oncogene c-Sis, PDGF2, SIS, Platelet-derived growth factor B chain, PDGFB, Becaplermin, Platelet-derived growth factor beta polypeptide, Platelet-derived growth factor subunit B, PDGF subunit B
Reference ARO-A10939
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target PDGF-2, Proto-oncogene c-Sis, PDGF2, SIS, Platelet-derived growth factor B chain, PDGFB, Becaplermin, Platelet-derived growth factor beta polypeptide, Platelet-derived growth factor subunit B, PDGF subunit B
Clone Name SAA0449
Product name ARO-A10939-50
Uniprot ID P01127
Raw Antigen Sequence MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-PDGF-2, Proto-oncogene c-Sis, PDGF2, SIS, Platelet-derived growth factor B chain, PDGFB, Becaplermin, Platelet-derived growth factor beta polypeptide, Platelet-derived growth factor subunit B, PDGF subunit B
Reference ARO-A10939
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target PDGF-2, Proto-oncogene c-Sis, PDGF2, SIS, Platelet-derived growth factor B chain, PDGFB, Becaplermin, Platelet-derived growth factor beta polypeptide, Platelet-derived growth factor subunit B, PDGF subunit B
Clone Name SAA0449

Flow Cytometry results for Anti-Human PDGFB Antibody (SAA0449), FITC

Flow Cytometry results for Anti-Human PDGFB Antibody (SAA0449), FITC

Flow-cytometry using PE anti-human PDGFB antibody. MCF-7 cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an PE anti-human PDGFB monoclonal antibody (Catalog: ARO-A10939, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human PDGFB Antibody (SAA0449), FITC”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products