Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human PSCA Antibody (SAA0474), PE

Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG1, kappa
Clone Name:
SAA0474

Original price was: $687.00.Current price is: $528.00.

100ug 23% OFF + 528 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human PSCA Antibody (SAA0474), PE

Product name ARO-A10735-100
Uniprot ID O43653
Raw Antigen Sequence MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Prostate stem cell antigen, PSCA
Reference ARO-A10735
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target Prostate stem cell antigen, PSCA
Clone Name SAA0474
Product name ARO-A10735-1MG
Uniprot ID O43653
Raw Antigen Sequence MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Prostate stem cell antigen, PSCA
Reference ARO-A10735
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target Prostate stem cell antigen, PSCA
Clone Name SAA0474
Product name ARO-A10735-50
Uniprot ID O43653
Raw Antigen Sequence MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Prostate stem cell antigen, PSCA
Reference ARO-A10735
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target Prostate stem cell antigen, PSCA
Clone Name SAA0474

There are no reviews yet.

Be the first to review “Anti-Human PSCA Antibody (SAA0474), PE”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products