Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mk-4721 Biosimilar – Anti-PSCA mAb – Research Grade

  • PX-TA1121-50
  • 1 review
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $224.00.Current price is: $167.00.

50ug 25% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mk-4721 Biosimilar - Anti-PSCA mAb - Research Grade

Product name Mk-4721 Biosimilar - Anti-PSCA mAb - Research Grade
Uniprot ID O43653
Species Homo sapiens
Raw Antigen Sequence MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Mk-4721,AGS-PSCA,MK-4721,PSCA,anti-PSCA
Reference PX-TA1121
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Mk-4721 Biosimilar - Anti-PSCA mAb - Research Grade
Uniprot ID O43653
Species Homo sapiens
Raw Antigen Sequence MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Mk-4721,AGS-PSCA,MK-4721,PSCA,anti-PSCA
Reference PX-TA1121
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1121-50
Uniprot ID O43653
Species Homo sapiens
Raw Antigen Sequence MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Mk-4721,AGS-PSCA,MK-4721,PSCA,anti-PSCA
Reference PX-TA1121
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Mk-4721 Biosimilar – Anti-PSCA mAb – Research Grade

Mk-4721 is a novel biosimilar antibody that targets the prostate stem cell antigen (PSCA) and has shown promising results in preclinical studies. In this article, we will explore the structure, activity and potential applications of Mk-4721 as a therapeutic antibody.

Structure of Mk-4721 Biosimilar – Anti-PSCA mAb – Research Grade

Mk-4721 is a monoclonal antibody (mAb) that is designed to mimic the structure of the original anti-PSCA antibody. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The variable regions of the antibody, which are responsible for binding to PSCA, are located at the tips of the two heavy chains. The constant regions of the antibody provide stability and determine the effector functions of the antibody.

Activity of Mk-4721 Biosimilar – Anti-PSCA mAb – Research Grade

Mk-4721 binds specifically to PSCA, a protein that is overexpressed in several types of cancer, including prostate, bladder, and pancreatic cancer. By binding to PSCA, Mk-4721 blocks the interaction between PSCA and its signaling partners, leading to inhibition of tumor growth and survival. In addition, Mk-4721 has been shown to induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which are important mechanisms for the elimination of cancer cells.

Title: Potential Applications of Mk-4721 Biosimilar – Anti-PSCA mAb – Research Grade Mk-4721 has the potential to be used as a therapeutic antibody for the treatment of PSCA-expressing cancers. Preclinical studies have demonstrated that Mk-4721 has potent anti-tumor activity and can inhibit tumor growth in animal models of prostate cancer. In addition, Mk-4721 has shown promising results in combination with other anti- cancer therapies, such as chemotherapy and immune checkpoint inhibitors.

Advantages of Mk-4721 Biosimilar – Anti-PSCA mAb – Research Grade

One of the major advantages of Mk-4721 is its biosimilarity to the original anti-PSCA antibody. Biosimilars are highly similar to the reference product in terms of structure, function, and efficacy, and have the potential to provide a more affordable treatment option for patients. In addition, Mk-4721 is produced using recombinant DNA technology, which ensures batch-to-batch consistency and reduces the risk of contamination.

Title: Clinical Development of Mk-4721 Biosimilar – Anti-PSCA mAb – Research Grade Mk-4721 is currently in the preclinical stage of development, with plans to initiate clinical trials in the near future. The safety and efficacy of Mk-4721 will be evaluated in patients with PSCA-expressing cancers, and if successful, it could potentially become a new treatment option for these patients.

Conclusion

Mk-4721 is a promising biosimilar antibody that targets PSCA, a protein that is overexpressed in several types of cancer. Its structure and activity make it a potential therapeutic option for patients with PSCA-expressing cancers. With ongoing preclinical studies and plans for clinical development, Mk-4721 has the potential to make a significant impact in the field of cancer treatment.

SEC-HPLC of Research Grade MK-4721

SEC-HPLC of Research Grade MK-4721

Research Grade MK-4721was analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Research Grade MK-4721

SDS-PAGE for Research Grade MK-4721

Research Grade MK-4721, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Research Grade MK-4721

Flow Cytometry results for Research Grade MK-4721

Flow-cytometry using anti-human PSCA antibody. HPAC cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human PSCA monoclonal antibody (Catalog PX-TA1121, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a a Goat Anti-Human IgG H&L Polyclonal Antibody, FITC (abinScience: PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Mk-4721 Biosimilar - Anti-PSCA mAb - Research Grade

  • Vele — April 6, 2022

    Great product!

Show reviews in all languages (3)

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products