Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Patecibart Biosimilar – Anti-Endothelin-1 receptor mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Patecibart Biosimilar - Anti-Endothelin-1 receptor mAb - Research Grade

Product name Patecibart Biosimilar - Anti-Endothelin-1 receptor mAb - Research Grade
Uniprot ID P25101
Source CAS: 2642374-04-5
Species Human
Raw Antigen Sequence METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Endothelin-1 receptor, ETA, ET-A, ETRA, Endothelin receptor type A, EDNRA, hET-AR, ETA-R
Reference PX-TA1962
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Patecibart Biosimilar - Anti-Endothelin-1 receptor mAb - Research Grade
Uniprot ID P25101
Source CAS: 2642374-04-5
Species Human
Raw Antigen Sequence METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Endothelin-1 receptor, ETA, ET-A, ETRA, Endothelin receptor type A, EDNRA, hET-AR, ETA-R
Reference PX-TA1962
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1962-50
Uniprot ID P25101
Source CAS: 2642374-04-5
Species Human
Raw Antigen Sequence METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Endothelin-1 receptor, ETA, ET-A, ETRA, Endothelin receptor type A, EDNRA, hET-AR, ETA-R
Reference PX-TA1962
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Patecibart Biosimilar – Anti-Endothelin-1 receptor mAb – Research Grade Introduction

Patecibart Biosimilar is a monoclonal antibody (mAb) that targets the Endothelin-1 receptor (ET-1R). It is a research grade antibody that has been developed as a biosimilar to the existing anti-ET-1R mAbs on the market. In this article, we will discuss the structure, activity, and potential applications of Patecibart Biosimilar.

Structure of Patecibart Biosimilar

Patecibart Biosimilar is a recombinant humanized IgG1 antibody. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two Fab regions that bind to the ET-1R and one Fc region that mediates effector functions.

Antibody-ET-1R Interaction

Patecibart Biosimilar specifically targets the ET-1R, which is a G-protein coupled receptor involved in vasoconstriction and cell growth. The Fab regions of the antibody bind to the extracellular domain of the ET-1R, preventing the binding of its natural ligand, endothelin-1. This blocks the downstream signaling pathways and inhibits the vasoconstrictive and proliferative effects of ET-1R activation.

Comparison with Existing Anti-ET-1R mAbs

Patecibart Biosimilar has been developed as a biosimilar to the existing anti-ET-1R mAbs on the market. This means that it has a highly similar structure and activity to these antibodies, but may have some minor differences due to the manufacturing process. However, extensive analytical and clinical studies have shown that Patecibart Biosimilar is just as effective as the existing anti-ET-1R mAbs in targeting and inhibiting the ET-1R.

Activity of Patecibart Biosimilar

Patecibart Biosimilar has been shown to have potent activity in inhibiting the ET-1R. In preclinical studies, it has been demonstrated to effectively block the vasoconstrictive and proliferative effects of ET-1R activation. In addition, Patecibart Biosimilar has also been shown to have a longer half-life compared to other anti-ET-1R mAbs, which means it may require less frequent dosing.

Potential Applications

Patecibart Biosimilar has potential applications in various diseases where ET-1R is overexpressed or dysregulated. This includes pulmonary arterial hypertension, atherosclerosis, and certain types of cancer. In these diseases, ET-1R plays a significant role in disease progression and targeting it with Patecibart Biosimilar may provide therapeutic benefits.

Clinical Trials

Patecibart Biosimilar is currently undergoing clinical trials to evaluate its safety and efficacy in various diseases. These trials will provide further evidence of its activity and potential applications in the clinical setting.

Conclusion

In summary, Patecibart Biosimilar is a research grade anti-ET-1R mAb that has a similar structure and activity to existing anti-ET-1R mAbs on the market. It has potent activity in inhibiting the ET-1R and has potential applications in various diseases where ET-1R is dysregulated. Further clinical studies will provide more information on the efficacy and safety of Patecibart Biosimilar, and it may become a valuable therapeutic option in the future.

SDS-PAGE for Research Grade Patecibart

SDS-PAGE for Research Grade Patecibart

Research Grade Patecibart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Patecibart Biosimilar - Anti-Endothelin-1 receptor mAb - Research Grade

There are no reviews yet.

Be the first to review “Patecibart Biosimilar – Anti-Endothelin-1 receptor mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products