Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human S100A8 & S100A9 Polyclonal Antibody

  • ARO-A12673-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: $170.00.Current price is: $140.00.

50ug 18% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human S100A8 & S100A9 Polyclonal Antibody

Anti-Human S100A8 & S100A9 Polyclonal Antibody

Product name ARO-A12673-100
Uniprot ID P05109, P06702
Raw Antigen Sequence MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Protein S100-A8, Calgranulin-A, Calprotectin L1L subunit, Cystic fibrosis antigen, CFAG, Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8, MRP-8, p8, S100 calcium-binding protein A8, Urinary stone protein band A, S100A8, CAGA, CFAG, MRP8, Protein S100-A9, Calgranulin-B, Calprotectin L1H subunit, Leukocyte L1 complex heavy chain, Migration inhibitory factor-related protein 14, MRP-14, p14, S100 calcium-binding protein A9, S100A9, CAGB, CFAG, MRP14
Reference ARO-A12673
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human S100A8 & S100A9 ([Leu2-Glu93] & [Met1-Pro114]).
Product name ARO-A12673-1MG
Uniprot ID P05109, P06702
Raw Antigen Sequence MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Protein S100-A8, Calgranulin-A, Calprotectin L1L subunit, Cystic fibrosis antigen, CFAG, Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8, MRP-8, p8, S100 calcium-binding protein A8, Urinary stone protein band A, S100A8, CAGA, CFAG, MRP8, Protein S100-A9, Calgranulin-B, Calprotectin L1H subunit, Leukocyte L1 complex heavy chain, Migration inhibitory factor-related protein 14, MRP-14, p14, S100 calcium-binding protein A9, S100A9, CAGB, CFAG, MRP14
Reference ARO-A12673
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human S100A8 & S100A9 ([Leu2-Glu93] & [Met1-Pro114]).
Product name ARO-A12673-50
Uniprot ID P05109, P06702
Raw Antigen Sequence MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Protein S100-A8, Calgranulin-A, Calprotectin L1L subunit, Cystic fibrosis antigen, CFAG, Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8, MRP-8, p8, S100 calcium-binding protein A8, Urinary stone protein band A, S100A8, CAGA, CFAG, MRP8, Protein S100-A9, Calgranulin-B, Calprotectin L1H subunit, Leukocyte L1 complex heavy chain, Migration inhibitory factor-related protein 14, MRP-14, p14, S100 calcium-binding protein A9, S100A9, CAGB, CFAG, MRP14
Reference ARO-A12673
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human S100A8 & S100A9 ([Leu2-Glu93] & [Met1-Pro114]).

There are no reviews yet.

Be the first to review “Anti-Human S100A8 & S100A9 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products