Brand: ProteoGenix

Anti-Human SLC5A8 Polyclonal Antibody

PTX20543-100
Validated WB

Clonality:: Polyclonal Antibody
Host species:: Rabbit
Isotype:: IgG

Original price was: $393.00.Current price is: $309.00.

100ug 21% OFF + 309 loyalty points

Size Size

50ug Original price was: $296.00.Current price is: $217.00.
100ug Original price was: $393.00.Current price is: $309.00.
1MG Original price was: $1,166.00.Current price is: $897.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human SLC5A8 Polyclonal Antibody

Product name	PTX20543-100
Uniprot ID	Q8N695
Raw Antigen Sequence	AQIYPPLPERTLPLHLDIQGCNSTYNETNLMTTTEMPFTTSVFQIYNVQRTPLMDNWYSLS
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-SLC5A8
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	SLC5A8
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Product name	PTX20543-1MG
Uniprot ID	Q8N695
Raw Antigen Sequence	AQIYPPLPERTLPLHLDIQGCNSTYNETNLMTTTEMPFTTSVFQIYNVQRTPLMDNWYSLS
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-SLC5A8
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	SLC5A8
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Product name	PTX20543-50
Uniprot ID	Q8N695
Raw Antigen Sequence	AQIYPPLPERTLPLHLDIQGCNSTYNETNLMTTTEMPFTTSVFQIYNVQRTPLMDNWYSLS
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-SLC5A8
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	SLC5A8
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Datasheet

Anti-Human SLC5A8 Polyclonal Antibody binds to Recombinant Human SLC5A8 Protein, N-GST & C-His in WB Assay

Recombinant Human SLC5A8 Protein, N-GST & C-His(cat. No.ARO-P11367) can bind Anti-Human SLC5A8 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Human SLC5A8 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Human SLC5A8 Polyclonal Antibody

Anti-Human SLC5A8 Polyclonal Antibody

Anti-Human SLC5A8 Polyclonal Antibody binds to Recombinant Human SLC5A8 Protein, N-GST & C-His in WB Assay

Related products

Recombinant Human SLC5A8 Protein, N-GST & C-His

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human SLC5A8 Polyclonal Antibody

Specifications Anti-Human SLC5A8 Polyclonal Antibody

Documents

QC & Validation

Anti-Human SLC5A8 Polyclonal Antibody binds to Recombinant Human SLC5A8 Protein, N-GST & C-His in WB Assay

Reviews

Related products

Recombinant Human SLC5A8 Protein, N-GST & C-His

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human SLC5A8 Polyclonal Antibody