Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human TGFA/TGF-alpha Antibody (SAA0442), APC

Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG2a, kappa
Target species:
Human
Clone Name:
SAA0442

Original price was: $489.00.Current price is: $370.00.

50ug 24% OFF + 370 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human TGFA/TGF-alpha Antibody (SAA0442), APC

Anti-Human TGFA/TGF-alpha Antibody (SAA0442), APC

Product name ARO-A10434-100
Uniprot ID P01135
Raw Antigen Sequence MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-ETGF, Protransforming growth factor alpha, TGF type 1, TGFA, EGF-like TGF, TGF-alpha
Reference ARO-A10434
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target ETGF, Protransforming growth factor alpha, TGF type 1, TGFA, EGF-like TGF, TGF-alpha
Clone Name SAA0442
Target species Human
Product name ARO-A10434-1MG
Uniprot ID P01135
Raw Antigen Sequence MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-ETGF, Protransforming growth factor alpha, TGF type 1, TGFA, EGF-like TGF, TGF-alpha
Reference ARO-A10434
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target ETGF, Protransforming growth factor alpha, TGF type 1, TGFA, EGF-like TGF, TGF-alpha
Clone Name SAA0442
Target species Human
Product name ARO-A10434-50
Uniprot ID P01135
Raw Antigen Sequence MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-ETGF, Protransforming growth factor alpha, TGF type 1, TGFA, EGF-like TGF, TGF-alpha
Reference ARO-A10434
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target ETGF, Protransforming growth factor alpha, TGF type 1, TGFA, EGF-like TGF, TGF-alpha
Clone Name SAA0442
Target species Human

There are no reviews yet.

Be the first to review “Anti-Human TGFA/TGF-alpha Antibody (SAA0442), APC”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products