Brand: ProteoGenix

Anti-Human TREM2 VHH (SAA1136)

ARO-A16328-100
Validated ELISA

Note:: For research use only. Not suitable for human use.

Original price was: $560.00.Current price is: $452.00.

100ug 19% OFF + 452 loyalty points

Size Size

50ug Original price was: $427.00.Current price is: $317.00.
100ug Original price was: $560.00.Current price is: $452.00.
1MG Original price was: $1,771.00.Current price is: $1,311.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human TREM2 VHH (SAA1136)

Product name	ARO-A16328-100
Uniprot ID	Q9NZC2
Raw Antigen Sequence	MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	XtenCHO
Reactivity	Human
Aliases /Synonyms	anti-Triggering receptor expressed on myeloid cells 2, anti-Triggering receptor expressed on monocytes 2, anti-TREM-2, anti-TREM2
Reference	ARO-A16328
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	TREM2
Clone Name	SAA1136
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A16328-1MG
Uniprot ID	Q9NZC2
Raw Antigen Sequence	MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	XtenCHO
Reactivity	Human
Aliases /Synonyms	anti-Triggering receptor expressed on myeloid cells 2, anti-Triggering receptor expressed on monocytes 2, anti-TREM-2, anti-TREM2
Reference	ARO-A16328
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	TREM2
Clone Name	SAA1136
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A16328-50
Uniprot ID	Q9NZC2
Raw Antigen Sequence	MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	XtenCHO
Reactivity	Human
Aliases /Synonyms	anti-Triggering receptor expressed on myeloid cells 2, anti-Triggering receptor expressed on monocytes 2, anti-TREM-2, anti-TREM2
Reference	ARO-A16328
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	TREM2
Clone Name	SAA1136
Target species	Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

Datasheet

Anti-Human TREM2 VHH (SAA1136)

Anti-Human TREM2 VHH (SAA1136) can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Anti-Human TREM2 VHH (SAA1136)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Human TREM2 VHH (SAA1136)

Anti-Human TREM2 VHH (SAA1136)

Anti-Human TREM2 VHH (SAA1136)

Related products

Anti-Human TREM2 VHH (SAA1137)

Iluzanebart Biosimilar – Anti-Triggering receptor expressed on myeloid cells 2 mAb – Research Grade

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human TREM2 VHH (SAA1136)

Specifications Anti-Human TREM2 VHH (SAA1136)

Description

Documents

QC & Validation

Anti-Human TREM2 VHH (SAA1136)

3D Representation

Reviews

Related products

Anti-Human TREM2 VHH (SAA1137)

Iluzanebart Biosimilar – Anti-Triggering receptor expressed on myeloid cells 2 mAb – Research Grade

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human TREM2 VHH (SAA1136)