Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iluzanebart Biosimilar – Anti-Triggering receptor expressed on myeloid cells 2 mAb – Research Grade

  • PX-TA1952-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $208.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Iluzanebart Biosimilar - Anti-Triggering receptor expressed on myeloid cells 2 mAb - Research Grade

Product name Iluzanebart Biosimilar - Anti-Triggering receptor expressed on myeloid cells 2 mAb - Research Grade
Uniprot ID Q9NZC2
Source CAS: 2733621-19-5
Species Human
Raw Antigen Sequence MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2, TREM-2, TREM2
Reference PX-TA1952
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Iluzanebart Biosimilar - Anti-Triggering receptor expressed on myeloid cells 2 mAb - Research Grade
Uniprot ID Q9NZC2
Source CAS: 2733621-19-5
Species Human
Raw Antigen Sequence MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2, TREM-2, TREM2
Reference PX-TA1952
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1952-50
Uniprot ID Q9NZC2
Source CAS: 2733621-19-5
Species Human
Raw Antigen Sequence MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2, TREM-2, TREM2
Reference PX-TA1952
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Iluzanebart Biosimilar is a research grade monoclonal antibody (mAb) that targets the triggering receptor expressed on myeloid cells 2 (TREM2). This novel antibody has shown promising results in preclinical studies and is being developed as a potential therapeutic for various diseases. In this article, we will discuss the structure, activity, and potential applications of Iluzanebart Biosimilar in more detail.

Structure of Iluzanebart Biosimilar

Iluzanebart Biosimilar is a recombinant humanized IgG1 monoclonal antibody that is produced using advanced biotechnology techniques. It is composed of two heavy chains and two light chains, each containing specific amino acid sequences that determine its unique structure and function. The antibody has a molecular weight of approximately 150 kDa and a half-life of approximately 21 days in humans.

Activity of Iluzanebart Biosimilar

Iluzanebart Biosimilar specifically binds to TREM2, a transmembrane protein that is expressed on the surface of myeloid cells, including microglia, macrophages, and dendritic cells. TREM2 is involved in regulating immune responses and has been implicated in various diseases, including Alzheimer’s disease, multiple sclerosis, and cancer.

Iluzanebart Biosimilar binds to TREM2 with high affinity, thereby blocking its interaction with its ligands and inhibiting downstream signaling pathways. This leads to a decrease in the activation of myeloid cells and a reduction in the production of pro-inflammatory cytokines. Additionally, Iluzanebart Biosimilar has been shown to promote the phagocytic activity of myeloid cells, which helps in the clearance of cellular debris and pathogens.

Applications of Iluzanebart Biosimilar

Given its ability to modulate the activity of myeloid cells, Iluzanebart Biosimilar has potential applications in various diseases where these cells play a critical role. Some of the potential therapeutic areas where Iluzanebart Biosimilar may be beneficial include:

1. Neurodegenerative diseases: TREM2 has been implicated in the pathogenesis of Alzheimer’s disease, Parkinson’s disease, and other neurodegenerative disorders. Iluzanebart Biosimilar has shown promising results in preclinical studies as a potential treatment for these diseases by reducing neuroinflammation and promoting the clearance of toxic proteins.

2. Autoimmune diseases: Myeloid cells play a crucial role in the development and progression of autoimmune diseases such as multiple sclerosis, rheumatoid arthritis, and lupus. By targeting TREM2, Iluzanebart Biosimilar has the potential to modulate the activity of these cells and alleviate symptoms of these diseases.

3.

Cancer: Myeloid cells can promote tumor growth and metastasis through their pro-inflammatory and immunosuppressive activities. Iluzanebart Biosimilar has shown promising results in preclinical studies as a potential immunotherapy for various types of cancer by inhibiting myeloid cell activity and promoting anti-tumor immune responses.

Conclusion

Iluzanebart Biosimilar is a novel monoclonal antibody that specifically targets TREM2, a protein involved in regulating immune responses. By blocking TREM2 activity, Iluzanebart Biosimilar has the potential to modulate the activity of myeloid cells and alleviate symptoms of various diseases, including neurodegenerative diseases, autoimmune diseases, and cancer. Further clinical studies are needed to fully evaluate the therapeutic potential of Iluzanebart Biosimilar.

SDS-PAGE for Research Grade Iluzanebart

SDS-PAGE for Research Grade Iluzanebart

Research Grade Iluzanebart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Research Grade Iluzanebart in ELISA Assay

Research Grade Iluzanebart in ELISA Assay

Research Grade Iluzanebart can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Iluzanebart Biosimilar - Anti-Triggering receptor expressed on myeloid cells 2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Iluzanebart Biosimilar – Anti-Triggering receptor expressed on myeloid cells 2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products