Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human UBE2D3 Polyclonal Antibody

Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: $181.00.Current price is: $140.00.

50ug 23% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human UBE2D3 Polyclonal Antibody

Anti-Human UBE2D3 Polyclonal Antibody

Product name ARO-A11870-100
Uniprot ID P61077
Raw Antigen Sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Ubiquitin-conjugating enzyme E2-17 kDa 3, (E3-independent) E2 ubiquitin-conjugating enzyme D3, UBC5C, UBE2D3, Ubiquitin-conjugating enzyme E2(17)KB 3, Ubiquitin carrier protein D3, Ubiquitin-protein ligase D3, UBCH5C, Ubiquitin-conjugating enzyme E2 D3, E2 ubiquitin-conjugating enzyme D3
Reference ARO-A11870
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human UBE2D3 (Met1-Met147).
Product name ARO-A11870-1MG
Uniprot ID P61077
Raw Antigen Sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Ubiquitin-conjugating enzyme E2-17 kDa 3, (E3-independent) E2 ubiquitin-conjugating enzyme D3, UBC5C, UBE2D3, Ubiquitin-conjugating enzyme E2(17)KB 3, Ubiquitin carrier protein D3, Ubiquitin-protein ligase D3, UBCH5C, Ubiquitin-conjugating enzyme E2 D3, E2 ubiquitin-conjugating enzyme D3
Reference ARO-A11870
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human UBE2D3 (Met1-Met147).
Product name ARO-A11870-50
Uniprot ID P61077
Raw Antigen Sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Ubiquitin-conjugating enzyme E2-17 kDa 3, (E3-independent) E2 ubiquitin-conjugating enzyme D3, UBC5C, UBE2D3, Ubiquitin-conjugating enzyme E2(17)KB 3, Ubiquitin carrier protein D3, Ubiquitin-protein ligase D3, UBCH5C, Ubiquitin-conjugating enzyme E2 D3, E2 ubiquitin-conjugating enzyme D3
Reference ARO-A11870
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human UBE2D3 (Met1-Met147).

There are no reviews yet.

Be the first to review “Anti-Human UBE2D3 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products