Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human WFDC2/WAP5 VHH (SAA1359)

Note:
For research use only. Not suitable for human use.

$452.00

100ug + 452 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human WFDC2/WAP5 VHH (SAA1359)

Product name Anti-Human WFDC2/WAP5 VHH (SAA1359)
Uniprot ID Q14508
Raw Antigen Sequence MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Epididymal secretory protein E4, anti-Major epididymis-specific protein E4, anti-HE4, anti-WFDC2, anti-WAP5, anti-WAP four-disulfide core domain protein 2, anti-Putative protease inhibitor WAP5
Reference ARO-A16364
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen WFDC2/WAP5
Clone Name SAA1359
Target species Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

SDS-PAGE for Anti-Human WFDC2/WAP5 VHH (SAA1359)

SDS-PAGE for Anti-Human WFDC2/WAP5 VHH (SAA1359)

Anti-Human WFDC2/WAP5 VHH (SAA1359), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human WFDC2/WAP5 VHH (SAA1359)

There are no reviews yet.

Be the first to review “Anti-Human WFDC2/WAP5 VHH (SAA1359)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products