Brand: ProteoGenix

Anti-MMP15 Polyclonal Antibody

PTX19723-50
Validated WB

Clonality:: Polyclonal Antibody
Host species:: Rabbit
Isotype:: IgG

Original price was: $186.00.Current price is: $140.00.

50ug 25% OFF + 140 loyalty points

Size Size

50ug Original price was: $186.00.Current price is: $140.00.
100ug Original price was: $242.00.Current price is: $201.00.
1MG Original price was: $804.00.Current price is: $583.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-MMP15 Polyclonal Antibody

Product name	PTX19723-100
Uniprot ID	P51511
Raw Antigen Sequence	HFWRGLPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFFFQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNERLRMEPGYPKSIL
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-MMP15
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	Human,Mouse,Rat

Product name	PTX19723-1MG
Uniprot ID	P51511
Raw Antigen Sequence	HFWRGLPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFFFQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNERLRMEPGYPKSIL
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-MMP15
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	Human,Mouse,Rat

Product name	PTX19723-50
Uniprot ID	P51511
Raw Antigen Sequence	HFWRGLPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFFFQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNERLRMEPGYPKSIL
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-MMP15
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	Human,Mouse,Rat

Datasheet

Anti-MMP15 Polyclonal Antibody binds to Recombinant Human MMP15, N-His in WB Assay

Recombinant Human MMP15, N-His(cat. No.ARO-P13665) can bind Anti-MMP15 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-MMP15 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-MMP15 Polyclonal Antibody

Anti-MMP15 Polyclonal Antibody

Anti-MMP15 Polyclonal Antibody binds to Recombinant Human MMP15, N-His in WB Assay

Related products

Recombinant Human MMP15, N-His

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-MMP15 Polyclonal Antibody

Specifications Anti-MMP15 Polyclonal Antibody

Documents

QC & Validation

Anti-MMP15 Polyclonal Antibody binds to Recombinant Human MMP15, N-His in WB Assay

Reviews

Related products

Recombinant Human MMP15, N-His

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-MMP15 Polyclonal Antibody