Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse CD152/CTLA4 Antibody (9D9)

  • ARO-A15658-50
  • Validated ELISA

Original price was: $405.00.Current price is: $324.00.

50ug 20% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse CD152/CTLA4 Antibody (9D9)

Product name ARO-A15658-100
Uniprot ID P09793
Raw Antigen Sequence MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15658
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD152/CTLA4
Clone Name 9D9
Protein Name CD152/CTLA4
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15658-1MG
Uniprot ID P09793
Raw Antigen Sequence MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15658
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD152/CTLA4
Clone Name 9D9
Protein Name CD152/CTLA4
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15658-50
Uniprot ID P09793
Raw Antigen Sequence MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15658
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD152/CTLA4
Clone Name 9D9
Protein Name CD152/CTLA4
Target species Anti-Mouse Monoclonal Antibody

Anti-Mouse CD152/CTLA4 Antibody (9D9) binds to Mouse CD152 recombinant protein in ELISA Assay

Anti-Mouse CD152/CTLA4 Antibody (9D9) binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Anti-Mouse CD152/CTLA4 Antibody (9D9) in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Mouse CD152/CTLA4 Antibody (9D9)

There are no reviews yet.

Be the first to review “Anti-Mouse CD152/CTLA4 Antibody (9D9)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products