Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Mouse CD8a/Lyt2 Antibody (2.43), FITC

  • ARO-A10912-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Rat
Isotype:
IgG2b
Clone Name:
2,43

Original price was: $209.00.Current price is: $157.00.

50ug 25% OFF + 157 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Anti-Mouse CD8a/Lyt2 Antibody (2.43), FITC

Anti-Mouse CD8a/Lyt2 Antibody (2.43), FITC

Product name ARO-A10912-100
Uniprot ID P01731
Raw Antigen Sequence MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rat
Aliases /Synonyms Anti-T-cell surface glycoprotein CD8 alpha chain, T-cell surface glycoprotein Lyt-2, CD8a, Cd8a, Lyt-2, Lyt2,cd8
Reference ARO-A10912
Note For research use only.
Isotype IgG2b
Clonality Monoclonal Antibody
Target T-cell surface glycoprotein CD8 alpha chain, T-cell surface glycoprotein Lyt-2, CD8a, Cd8a, Lyt-2, Lyt2,cd8
Clone Name 2,43
Product name ARO-A10912-1MG
Uniprot ID P01731
Raw Antigen Sequence MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rat
Aliases /Synonyms Anti-T-cell surface glycoprotein CD8 alpha chain, T-cell surface glycoprotein Lyt-2, CD8a, Cd8a, Lyt-2, Lyt2,cd8
Reference ARO-A10912
Note For research use only.
Isotype IgG2b
Clonality Monoclonal Antibody
Target T-cell surface glycoprotein CD8 alpha chain, T-cell surface glycoprotein Lyt-2, CD8a, Cd8a, Lyt-2, Lyt2,cd8
Clone Name 2,43
Product name ARO-A10912-50
Uniprot ID P01731
Raw Antigen Sequence MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rat
Aliases /Synonyms Anti-T-cell surface glycoprotein CD8 alpha chain, T-cell surface glycoprotein Lyt-2, CD8a, Cd8a, Lyt-2, Lyt2,cd8
Reference ARO-A10912
Note For research use only.
Isotype IgG2b
Clonality Monoclonal Antibody
Target T-cell surface glycoprotein CD8 alpha chain, T-cell surface glycoprotein Lyt-2, CD8a, Cd8a, Lyt-2, Lyt2,cd8
Clone Name 2,43

Flow Cytometry results for Anti-Mouse CD8a/Lyt2 Antibody (2.43), FITC

Flow Cytometry results for Anti-Mouse CD8a/Lyt2 Antibody (2.43), FITC

Target Cells were stained with an irrelevant antibody or Anti-Mouse CD8a/Lyt2 Antibody (2.43), FITC at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Mouse CD8a/Lyt2 Antibody (2.43), FITC”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products