Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD8A Monoclonal Antibody

  • ARO-A15794-50
  • Validated ELISA

Original price was: $288.00.Current price is: $236.00.

50ug 18% OFF + 236 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SEC-HPLC of Human CD8A Monoclonal Antibody
Human CD8A Monoclonal Antibody

Human CD8A Monoclonal Antibody

Product name ARO-A15794-100
Uniprot ID P01732
Uniprot link P01732
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A
Reference ARO-A15794
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD8A
Clone Name mab1
Protein Name CD8A
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15794-1MG
Uniprot ID P01732
Uniprot link P01732
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A
Reference ARO-A15794
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD8A
Clone Name mab1
Protein Name CD8A
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15794-50
Uniprot ID P01732
Uniprot link P01732
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A
Reference ARO-A15794
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD8A
Clone Name mab1
Protein Name CD8A
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Human CD8A Monoclonal Antibody

SEC-HPLC of Human CD8A Monoclonal Antibody

Human CD8A Monoclonal Antibodywas analyzed by size exclusion chromatography with UV detection.

Human CD8A Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD8A Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products