Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Mouse HMGB1 Antibody (DPH1.1)

  • ARO-A15083-100
  • Validated WB

Original price was: $555.00.Current price is: $462.00.

100ug 17% OFF + 462 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Mouse HMGB1 Antibody (DPH1.1)
Anti-Mouse HMGB1 Antibody (DPH1.1) binds to Mouse HMGB1 Protein, N-His, recombinant protein in WB Assay
Anti-Mouse HMGB1 Antibody (DPH1.1)

Anti-Mouse HMGB1 Antibody (DPH1.1)

Product name ARO-A15083-100
Uniprot ID P63158
Raw Antigen Sequence MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rat
Reactivity Mouse
Reference ARO-A15083
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen High mobility group protein B1, HMGB1, HMG1, HMG-1, High mobility group protein 1
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15083-1MG
Uniprot ID P63158
Raw Antigen Sequence MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rat
Reactivity Mouse
Reference ARO-A15083
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen High mobility group protein B1, HMGB1, HMG1, HMG-1, High mobility group protein 1
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15083-50
Uniprot ID P63158
Raw Antigen Sequence MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rat
Reactivity Mouse
Reference ARO-A15083
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen High mobility group protein B1, HMGB1, HMG1, HMG-1, High mobility group protein 1
Target species Anti-Mouse Monoclonal Antibody

SDS-PAGE for Anti-Mouse HMGB1 Antibody (DPH1.1)

SDS-PAGE for Anti-Mouse HMGB1 Antibody (DPH1.1)

Anti-Mouse HMGB1 Antibody (DPH1.1), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Mouse HMGB1 Antibody (DPH1.1) binds to Mouse HMGB1 Protein, N-His, recombinant protein in WB Assay

Anti-Mouse HMGB1 Antibody (DPH1.1) binds to Mouse HMGB1 Protein, N-His, recombinant protein in WB Assay

Mouse HMGB1 Protein, N-His, recombinant protein(cat. No.PX-P5985) can bind Anti-Mouse HMGB1 Antibody (DPH1.1) in Western Blot Assay as detected on gel analysis.

Anti-Mouse HMGB1 Antibody (DPH1.1)

There are no reviews yet.

Be the first to review “Anti-Mouse HMGB1 Antibody (DPH1.1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products