Brand: ProteoGenix

Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

ARO-A15618-100
Quality Chart

Original price was: $638.00.Current price is: $465.00.

100ug 27% OFF + 465 loyalty points

Size Size

50ug Original price was: $437.00.Current price is: $326.00.
100ug Original price was: $638.00.Current price is: $465.00.
1MG Original price was: $1,741.00.Current price is: $1,349.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

Datasheet

Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

Product name	ARO-A15618-100
Uniprot ID	P35461
Raw Antigen Sequence	MDTCHIAKSCVLILLVVLLCAERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAGVLLFSLVSVLLQTFL
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Mouse
Reference	ARO-A15618
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	Ly6g/Ly-6G.1
Clone Name	1A8
Protein Name	Ly6g/Ly-6G.1
Target species	Anti-Mouse Monoclonal Antibody

Product name	ARO-A15618-1MG
Uniprot ID	P35461
Raw Antigen Sequence	MDTCHIAKSCVLILLVVLLCAERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAGVLLFSLVSVLLQTFL
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Mouse
Reference	ARO-A15618
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	Ly6g/Ly-6G.1
Clone Name	1A8
Protein Name	Ly6g/Ly-6G.1
Target species	Anti-Mouse Monoclonal Antibody

Product name	ARO-A15618-50
Uniprot ID	P35461
Raw Antigen Sequence	MDTCHIAKSCVLILLVVLLCAERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAGVLLFSLVSVLLQTFL
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Mouse
Reference	ARO-A15618
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	Ly6g/Ly-6G.1
Clone Name	1A8
Protein Name	Ly6g/Ly-6G.1
Target species	Anti-Mouse Monoclonal Antibody

Datasheet

SDS-PAGE for Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

SDS-PAGE for Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

Related products

Rat IgG2a, kappa Isotype Control Antibody (RTK2758), PerCP

Mouse LY6G Recombinant Protein, N-His

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

Specifications Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

Documents

QC & Validation

SDS-PAGE for Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

3D Representation

Reviews

Related products

Rat IgG2a, kappa Isotype Control Antibody (RTK2758), PerCP

Mouse LY6G Recombinant Protein, N-His

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)