Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Mouse VSIG1 Polyclonal Antibody

  • ARO-A11017-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: $194.00.Current price is: $140.00.

50ug 28% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Mouse VSIG1 Polyclonal Antibody binds to Recombinant Mouse VSIG1 Protein, N-His in WB Assay

Anti-Mouse VSIG1 Polyclonal Antibody

Product name ARO-A11017-100
Uniprot ID Q9D2J4
Raw Antigen Sequence MVQVTIPDTFVNVTVGSNVTLLCLYTTTEKSLEKLSIQWSFFHNKEMEEPISIYYSEGGQASAIGQFKDRIIGATNPGNASITILHMQPADSGIYICDVNNPPHFVGKNQGLLDVTVLVKPSKPFCTIQGRPEAGHPISLSCLSAFGTPSPLYYWYNIEGNTIVPVKESFNTATGVLVIGNLTNFEQGYYQCTAINSLGNSSCEID
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-V-set and immunoglobulin domain-containing protein 1 (Cell surface A33 antigen) (Glycoprotein A34)
Reference ARO-A11017
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse VSIG1 (Met22-Asp227).
Product name ARO-A11017-1MG
Uniprot ID Q9D2J4
Raw Antigen Sequence MVQVTIPDTFVNVTVGSNVTLLCLYTTTEKSLEKLSIQWSFFHNKEMEEPISIYYSEGGQASAIGQFKDRIIGATNPGNASITILHMQPADSGIYICDVNNPPHFVGKNQGLLDVTVLVKPSKPFCTIQGRPEAGHPISLSCLSAFGTPSPLYYWYNIEGNTIVPVKESFNTATGVLVIGNLTNFEQGYYQCTAINSLGNSSCEID
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-V-set and immunoglobulin domain-containing protein 1 (Cell surface A33 antigen) (Glycoprotein A34)
Reference ARO-A11017
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse VSIG1 (Met22-Asp227).
Product name ARO-A11017-50
Uniprot ID Q9D2J4
Raw Antigen Sequence MVQVTIPDTFVNVTVGSNVTLLCLYTTTEKSLEKLSIQWSFFHNKEMEEPISIYYSEGGQASAIGQFKDRIIGATNPGNASITILHMQPADSGIYICDVNNPPHFVGKNQGLLDVTVLVKPSKPFCTIQGRPEAGHPISLSCLSAFGTPSPLYYWYNIEGNTIVPVKESFNTATGVLVIGNLTNFEQGYYQCTAINSLGNSSCEID
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-V-set and immunoglobulin domain-containing protein 1 (Cell surface A33 antigen) (Glycoprotein A34)
Reference ARO-A11017
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse VSIG1 (Met22-Asp227).

Anti-Mouse VSIG1 Polyclonal Antibody binds to Recombinant Mouse VSIG1 Protein, N-His in WB Assay

Anti-Mouse VSIG1 Polyclonal Antibody binds to Recombinant Mouse VSIG1 Protein, N-His in WB Assay

Recombinant Mouse VSIG1 Protein, N-His(cat. No.ARO-P10984) can bind Anti-Mouse VSIG1 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Mouse VSIG1 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products