Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody

  • PTX19928-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: $181.00.Current price is: $140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody

Product name PTX19928-100
Uniprot ID Q9Y6L6
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-SLCO1B1, Anti-LST-1, Anti-OATP-2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human
Product name PTX19928-1MG
Uniprot ID Q9Y6L6
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-SLCO1B1, Anti-LST-1, Anti-OATP-2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human
Product name PTX19928-50
Uniprot ID Q9Y6L6
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-SLCO1B1, Anti-LST-1, Anti-OATP-2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human

Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody binds to Recombinant Human SLCO1B1/LST-1/OATP-2, N-His in WB Assay

Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody binds to Recombinant Human SLCO1B1/LST-1/OATP-2, N-His in WB Assay

Recombinant Human SLCO1B1/LST-1/OATP-2, N-His(cat. No.ARO-P12792) can bind Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products