Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLCO1B1/LST-1/OATP-2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y6L6
Molecular weight:
12.45 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Phe426–Phe537
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLCO1B1/LST-1/OATP-2, N-His

Product name ARO-P12792-100
Uniprot ID Q9Y6L6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Molecular weight 12.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe426-Phe537
Aliases /Synonyms LST1, OATP1B1, OATP2, SLCO1B1, Solute carrier family 21 member 6, OATP-2, Sodium-independent organic anion-transporting polypeptide 2, LST-1, SLC21A6, OATP-C, OATPC, Solute carrier organic anion transporter family member 1B1, Liver-specific organic anion transporter 1
Reference ARO-P12792
Note For research use only.
Molecular Constructor
Phe426–Phe537
Product name ARO-P12792-1MG
Uniprot ID Q9Y6L6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Molecular weight 12.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe426-Phe537
Aliases /Synonyms LST1, OATP1B1, OATP2, SLCO1B1, Solute carrier family 21 member 6, OATP-2, Sodium-independent organic anion-transporting polypeptide 2, LST-1, SLC21A6, OATP-C, OATPC, Solute carrier organic anion transporter family member 1B1, Liver-specific organic anion transporter 1
Reference ARO-P12792
Note For research use only.
Molecular Constructor
Phe426–Phe537
Product name ARO-P12792-50
Uniprot ID Q9Y6L6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Molecular weight 12.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe426-Phe537
Aliases /Synonyms LST1, OATP1B1, OATP2, SLCO1B1, Solute carrier family 21 member 6, OATP-2, Sodium-independent organic anion-transporting polypeptide 2, LST-1, SLC21A6, OATP-C, OATPC, Solute carrier organic anion transporter family member 1B1, Liver-specific organic anion transporter 1
Reference ARO-P12792
Note For research use only.
Molecular Constructor
Phe426–Phe537

Structure of Recombinant Human SLCO1B1/LST-1/OATP-2

Recombinant Human SLCO1B1/LST-1/OATP-2 is a protein that belongs to the solute carrier organic anion transporter family. It is also known as liver-specific organic anion transporter 1 (LST-1) or organic anion-transporting polypeptide 2 (OATP-2). This protein is encoded by the SLCO1B1 gene and is primarily expressed in the liver.

The structure of Recombinant Human SLCO1B1/LST-1/OATP-2 consists of 12 transmembrane domains and a large extracellular loop. It also contains a glycosylation site in the extracellular loop, which is important for its proper functioning. The protein has a molecular weight of approximately 80 kDa and is highly conserved among different species.

Activity of Recombinant Human SLCO1B1/LST-1/OATP-2

Recombinant Human SLCO1B1/LST-1/OATP-2 is a membrane-bound protein that plays a crucial role in the transport of various endogenous and exogenous compounds across the cell membrane. It acts as a carrier protein, facilitating the uptake of a wide range of substrates, including bile acids, hormones, and drugs.

The activity of this protein is mainly dependent on its ability to bind to and transport substrates. It has a high affinity for organic anions and can also transport cations, making it a bidirectional transporter. The transport of substrates by Recombinant Human SLCO1B1/LST-1/OATP-2 is driven by the transmembrane electrochemical gradient, making it an active transporter.

Application of Recombinant Human SLCO1B1/LST-1/OATP-2

The activity of Recombinant Human SLCO1B1/LST-1/OATP-2 has important implications in various physiological processes and has been linked to several diseases. Its role in the transport of bile acids is essential for maintaining bile acid homeostasis, and any dysfunction in this process can lead to liver diseases, such as cholestasis.

The protein also plays a crucial role in the absorption, distribution, and elimination of drugs in the body. Its expression in the liver allows it to regulate the levels of drugs in the blood, making it an important factor in drug efficacy and toxicity. Variations in the SLCO1B1 gene have been associated with altered drug response and increased risk of adverse drug reactions.

In addition to its physiological roles, Recombinant Human SLCO1B1/LST-1/OATP-2 has also been extensively studied for its potential therapeutic applications. Due to its ability to transport a wide range of substrates, it has been explored as a drug delivery target for various diseases, such as cancer, viral infections, and metabolic disorders.

Furthermore, Recombinant Human SLCO1B1/LST-1/OATP-2 has been used in research studies to investigate the transport mechanisms of different compounds and to develop new drug therapies. The recombinant protein has also been used in drug screening assays to identify potential substrates and inhibitors for this transporter.

Conclusion

In summary, Recombinant Human SLCO1B1/LST-1/OATP-2 is a membrane-bound protein with 12 transmembrane domains and a large extracellular loop. It plays a crucial role in the transport of various endogenous and exogenous compounds, including bile acids, hormones, and drugs. Its activity is essential for maintaining normal physiological functions and has important implications in disease states. The recombinant protein has also been widely used in research and drug development, making it a valuable tool in the scientific community.

Recombinant Human SLCO1B1/LST-1/OATP-2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SLCO1B1/LST-1/OATP-2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products