Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CEP97 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IW35
Molecular weight:
23.18 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Val18–Asn205
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CEP97 Protein, N-His

Product name ARO-P12432-100
Uniprot ID Q8IW35
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VNWSGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNN
Molecular weight 23.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val18-Asn205
Aliases /Synonyms Cep97, Leucine-rich repeat and IQ domain-containing protein 2, LRRIQ2, CEP97, Centrosomal protein of 97 kDa
Reference ARO-P12432
Note For research use only.
Molecular Constructor
Val18–Asn205
Product name ARO-P12432-1MG
Uniprot ID Q8IW35
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VNWSGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNN
Molecular weight 23.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val18-Asn205
Aliases /Synonyms Cep97, Leucine-rich repeat and IQ domain-containing protein 2, LRRIQ2, CEP97, Centrosomal protein of 97 kDa
Reference ARO-P12432
Note For research use only.
Molecular Constructor
Val18–Asn205
Product name ARO-P12432-50
Uniprot ID Q8IW35
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VNWSGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNN
Molecular weight 23.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val18-Asn205
Aliases /Synonyms Cep97, Leucine-rich repeat and IQ domain-containing protein 2, LRRIQ2, CEP97, Centrosomal protein of 97 kDa
Reference ARO-P12432
Note For research use only.
Molecular Constructor
Val18–Asn205

Introduction

Recombinant Human CEP97 Protein, also known as centrosomal protein 97, is a highly conserved protein that plays a critical role in cell division and centrosome function. It is encoded by the CEP97 gene and is a key component of the centrosome, a cellular organelle responsible for organizing the microtubule network during cell division.

Structure of Recombinant Human CEP97 Protein

The recombinant form of CEP97 protein is produced through genetic engineering techniques, where the CEP97 gene is inserted into a suitable expression vector and then expressed in a host cell. The resulting protein is identical to the natural form of CEP97, with a molecular weight of approximately 97 kDa.

The structure of CEP97 protein is characterized by a coiled-coil domain at the N-terminus and a C-terminal domain containing a conserved WD40 repeat motif. This unique structure allows CEP97 to interact with various proteins, including other centrosomal proteins, to regulate centrosome function.

Function of Recombinant Human CEP97 Protein

CEP97 is a crucial component of the centrosome, where it plays a critical role in centrosome duplication and maturation. During cell division, the centrosome duplicates to form two new centrosomes, which are essential for organizing the microtubule network and ensuring proper cell division.

CEP97 is involved in the recruitment and assembly of other centrosomal proteins, such as CEP152 and CEP192, to the centrosome. It also regulates the activity of these proteins, ensuring proper centrosome function. Additionally, CEP97 is required for the maintenance of the structural integrity of the centrosome.

Application of Recombinant Human CEP97 Protein

Due to its critical role in cell division and centrosome function, recombinant human CEP97 protein has various applications in scientific research and drug development.

One of the main applications of CEP97 protein is in the study of centrosome biology and cell division. By studying the function and interactions of CEP97 with other centrosomal proteins, researchers can gain a better understanding of the mechanisms involved in centrosome duplication and maturation. This knowledge can also help in identifying potential targets for therapeutic intervention in diseases related to centrosome dysfunction, such as cancer.

Recombinant CEP97 protein can also be used in drug development, particularly in the development of anti-cancer drugs. As CEP97 is overexpressed in many types of cancer, targeting this protein could potentially inhibit cancer cell growth and proliferation. Additionally, CEP97 has been found to be essential for the survival of cancer cells, making it a promising target for cancer therapy.

Conclusion

In summary, recombinant human CEP97 protein is a crucial component of the centrosome, playing a critical role in cell division and centrosome function. Its unique structure and interactions with other centrosomal proteins make it an important target for scientific research and drug development. With its various applications, CEP97 protein continues to be a valuable tool in advancing our understanding of cell biology and in the development of new therapies for diseases related to centrosome dysfunction.

Recombinant Human CEP97 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CEP97 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products