Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DDX21 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NR30
Molecular weight:
44.50 kDa

Original price was: $264.00.Current price is: $230.00.

50ug 13% OFF + 230 loyalty points
Ala187–Ile563
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DDX21 Protein, N-His

Product name ARO-P12431-100
Uniprot ID Q9NR30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRI
Molecular weight 44.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala187-Ile563
Aliases /Synonyms DEAD box protein 21, DDX21, Gu-alpha, Nucleolar RNA helicase II, RH II/Gu, Nucleolar RNA helicase Gu, Nucleolar RNA helicase 2
Reference ARO-P12431
Note For research use only.
Molecular Constructor
Ala187–Ile563
Product name ARO-P12431-1MG
Uniprot ID Q9NR30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRI
Molecular weight 44.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala187-Ile563
Aliases /Synonyms DEAD box protein 21, DDX21, Gu-alpha, Nucleolar RNA helicase II, RH II/Gu, Nucleolar RNA helicase Gu, Nucleolar RNA helicase 2
Reference ARO-P12431
Note For research use only.
Molecular Constructor
Ala187–Ile563
Product name ARO-P12431-50
Uniprot ID Q9NR30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRI
Molecular weight 44.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala187-Ile563
Aliases /Synonyms DEAD box protein 21, DDX21, Gu-alpha, Nucleolar RNA helicase II, RH II/Gu, Nucleolar RNA helicase Gu, Nucleolar RNA helicase 2
Reference ARO-P12431
Note For research use only.
Molecular Constructor
Ala187–Ile563

Introduction

Recombinant Human DDX21 Protein, also known as DEAD-box helicase 21, is a vital protein involved in various cellular processes such as RNA metabolism, transcription, and translation. This protein is encoded by the DDX21 gene and is highly conserved among different species, indicating its essential role in cellular function. In this article, we will discuss the structure, activity, and applications of Recombinant Human DDX21 Protein.

Structure of Recombinant Human DDX21 Protein

Recombinant Human DDX21 Protein is a 72 kDa protein consisting of 660 amino acids. It belongs to the DEAD-box helicase family, which is characterized by the presence of a conserved motif (Asp-Glu-Ala-Asp) in the helicase domain. This motif is involved in the ATPase activity of the protein. DDX21 also contains a helicase core domain, two RNA-binding domains, and a C-terminal domain. The helicase core domain is responsible for the unwinding of RNA molecules, while the RNA-binding domains aid in the binding of RNA substrates. The C-terminal domain is involved in protein-protein interactions, which are crucial for the functioning of DDX21.

Activity of Recombinant Human DDX21 Protein

Recombinant Human DDX21 Protein has ATP-dependent RNA helicase activity, which is essential for its role in RNA metabolism. This protein binds to RNA molecules and uses the energy from ATP hydrolysis to unwind the RNA helix, allowing for the formation of secondary structures such as RNA loops and hairpins. DDX21 is also involved in the regulation of transcription and translation. It interacts with various transcription factors and RNA polymerase II, playing a crucial role in the transcription of genes. Additionally, DDX21 is involved in the translation of viral RNA, making it a potential target for antiviral therapies.

Applications of Recombinant Human DDX21 Protein

Recombinant Human DDX21 Protein has various applications in both research and therapeutic settings. Its role in RNA metabolism makes it an essential tool for studying RNA-related processes such as RNA splicing, RNA editing, and RNA transport. DDX21 is also involved in the immune response, and its dysregulation has been linked to autoimmune diseases. Therefore, it can be used as a biomarker for the diagnosis and monitoring of autoimmune disorders.

In the field of oncology, DDX21 has been identified as a potential therapeutic target. It is overexpressed in various cancers, including breast, lung, and colon cancer. Inhibition of DDX21 has been shown to decrease cell proliferation and induce cell death in cancer cells, making it a promising target for cancer treatment.

Moreover, Recombinant Human DDX21 Protein has been used in the development of vaccines against viral infections. DDX21 is involved in the recognition of viral RNA, and its activation leads to the production of type I interferons, which play a crucial role in the immune response against viruses. By using DDX21 as an antigen in vaccines, it can stimulate the production of antibodies against viral infections, providing protection against future infections.

Conclusion

In summary, Recombinant Human DDX21 Protein is a multifunctional protein involved in various cellular processes. Its structure, activity, and applications make it a valuable tool for studying RNA metabolism, as well as a potential target for therapeutic interventions. With ongoing research, the role of DDX21 in various diseases and its potential as a therapeutic target will continue to be explored, providing further insights into the functioning of this essential protein.

Recombinant Human DDX21 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DDX21 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products