Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PPP1R15B Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5SWA1
Molecular weight:
34.64 kDa

Original price was: $255.00.Current price is: $230.00.

50ug 10% OFF + 230 loyalty points
Gly660–Cys713
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PPP1R15B Protein, N-GST & C-His

Product name ARO-P12440-100
Uniprot ID Q5SWA1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPWEEFARDGCRFQKRIQETEDAIGYCLTFEHRERMFNRLQGTCFKGLNVLKQC
Molecular weight 34.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly660-Cys713
Aliases /Synonyms PPP1R15B, Protein phosphatase 1 regulatory subunit 15B
Reference ARO-P12440
Note For research use only.
Molecular Constructor
Gly660–Cys713
Product name ARO-P12440-1MG
Uniprot ID Q5SWA1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPWEEFARDGCRFQKRIQETEDAIGYCLTFEHRERMFNRLQGTCFKGLNVLKQC
Molecular weight 34.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly660-Cys713
Aliases /Synonyms PPP1R15B, Protein phosphatase 1 regulatory subunit 15B
Reference ARO-P12440
Note For research use only.
Molecular Constructor
Gly660–Cys713
Product name ARO-P12440-50
Uniprot ID Q5SWA1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPWEEFARDGCRFQKRIQETEDAIGYCLTFEHRERMFNRLQGTCFKGLNVLKQC
Molecular weight 34.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly660-Cys713
Aliases /Synonyms PPP1R15B, Protein phosphatase 1 regulatory subunit 15B
Reference ARO-P12440
Note For research use only.
Molecular Constructor
Gly660–Cys713

Introduction to Recombinant Human PPP1R15B Protein

Recombinant Human PPP1R15B Protein, also known as protein phosphatase 1 regulatory subunit 15B, is a highly conserved protein that plays a crucial role in regulating cellular response to stress. This protein is encoded by the PPP1R15B gene and is a member of the PPP1R15 family of proteins.

Structure of Recombinant Human PPP1R15B Protein

The Recombinant Human PPP1R15B Protein is a 203 amino acid long protein with a molecular weight of approximately 23 kDa. It contains a highly conserved C-terminal domain that is responsible for its interaction with protein phosphatase 1 (PP1) and a variable N-terminal domain that is involved in its regulatory functions.

The crystal structure of Recombinant Human PPP1R15B Protein has been determined, revealing a compact globular structure with a central beta-sheet surrounded by alpha-helices. This structure is highly similar to other members of the PPP1R15 family, indicating a conserved function among these proteins.

Activity of Recombinant Human PPP1R15B Protein

Recombinant Human PPP1R15B Protein is a key regulator of the integrated stress response (ISR) pathway. This pathway is activated in response to various stressors such as nutrient deprivation, hypoxia, and viral infection. The primary function of PPP1R15B is to inhibit protein synthesis by dephosphorylating eukaryotic initiation factor 2 alpha (eIF2α), a key regulator of translation initiation.

Under normal conditions, eIF2α is phosphorylated by kinases in response to stress, leading to a decrease in protein synthesis and conservation of cellular resources. However, prolonged eIF2α phosphorylation can have detrimental effects on cell survival. This is where Recombinant Human PPP1R15B Protein comes into play. It acts as a negative regulator of eIF2α phosphorylation, preventing excessive inhibition of protein synthesis and promoting cell survival.

Application of Recombinant Human PPP1R15B Protein

Recombinant Human PPP1R15B Protein has been extensively studied for its role in the ISR pathway and its potential applications in various fields. One of the major applications of this protein is in cancer research. The ISR pathway is often dysregulated in cancer cells, leading to increased protein synthesis and cell proliferation. By targeting PPP1R15B, researchers hope to develop new therapies for cancer treatment.

Another potential application of Recombinant Human PPP1R15B Protein is in the treatment of neurodegenerative diseases. Studies have shown that the ISR pathway is also involved in the pathogenesis of diseases such as Alzheimer’s and Parkinson’s. By targeting PPP1R15B, researchers aim to modulate the ISR pathway and potentially slow down the progression of these diseases.

Recombinant Human PPP1R15B Protein also has potential applications in the field of virology. Viruses often manipulate the ISR pathway for their own benefit, allowing them to replicate and spread. By targeting PPP1R15B, researchers hope to develop new antiviral therapies that can inhibit viral replication and prevent the spread of infection.

Conclusion

In summary, Recombinant Human PPP1R15B Protein is a highly conserved protein that plays a crucial role in regulating the ISR pathway. Its structure, activity, and potential applications make it a valuable protein for research in various fields, including cancer, neurodegenerative diseases, and virology. Further studies on this protein may lead to the development of new therapies for these diseases and provide a better understanding of the complex mechanisms involved in cellular stress response.

Recombinant Human PPP1R15B Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human PPP1R15B Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products