Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-TMPRSS2 polyclonal antibody

  • PTXCOV-A528-50
  • Validated WB
Note:
For research use and in vitro diagnostic only. Not suitable for human use.

Original price was: $184.00.Current price is: $140.00.

50ug 24% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-TMPRSS2 polyclonal antibody binds to Human TMPRSS2 recombinant protein in WB Assay
Anti-TMPRSS2 polyclonal antibody

Anti-TMPRSS2 polyclonal antibody

Product name PTXCOV-A528-100
Uniprot ID O15393
Source O15393
Species Human, other species were not tested
Raw Antigen Sequence SIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Molecular weight 54kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms PP9284, PRSS10, Serine protease 10, TMPRSS2
Size 100ug
Reference PTXCOV-A528
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant human TMPRSS2 protein
Product name PTXCOV-A528-1MG
Uniprot ID O15393
Source O15393
Species Human, other species were not tested
Raw Antigen Sequence SIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Molecular weight 54kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms PP9284, PRSS10, Serine protease 10, TMPRSS2
Size 100ug
Reference PTXCOV-A528
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant human TMPRSS2 protein
Product name PTXCOV-A528-50
Uniprot ID O15393
Source O15393
Species Human, other species were not tested
Raw Antigen Sequence SIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Molecular weight 54kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms PP9284, PRSS10, Serine protease 10, TMPRSS2
Size 100ug
Reference PTXCOV-A528
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant human TMPRSS2 protein

Anti-TMPRSS2 polyclonal antibody binds to Human TMPRSS2 recombinant protein in WB Assay

Anti-TMPRSS2 polyclonal antibody binds to Human TMPRSS2 recombinant protein in WB Assay

Human TMPRSS2 recombinant protein(cat. No.PX-P6517) can bind Anti-TMPRSS2 polyclonal antibody in Western Blot Assay as detected on gel analysis.

Anti-TMPRSS2 polyclonal antibody

There are no reviews yet.

Be the first to review “Anti-TMPRSS2 polyclonal antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products