Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) Envelope glycoprotein E2 recombinant protein

Host species:
Mammalian cells
Origin species:
Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)
Uniprot ID:
P19711
Molecular weight:
41.38 kDa

$500.00

100ug + 500 loyalty points
His693–Asp1030 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) Envelope glycoprotein E2 recombinant protein

Product name Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) Envelope glycoprotein E2 recombinant protein
Uniprot ID P19711
Origin species Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)
Expression system Eukaryotic expression
Raw Antigen Sequence HLDCKPEFSYAIAKDERIGQLGAEGLTTTWKEYSPGMKLEDTMVIAWCEDGKLMYLQRCTRETRYLAILHTRALPTSVVFKKLFDGRKQEDVVEMNDNFEFGLCPCDAKPIVRGKFNTTLLNGPAFQMVCPIGWTGTVSCTSFNMDTLATTVVRTYRRSKPFPHRQGCITQKNLGEDLHNCILGGNWTCVPGDQLLYKGGSIESCKWCGYQFKESEGLPHYPIGKCKLENETGYRLVDSTSCNREGVAIVPQGTLKCKIGKTTVQVIAMDTKLGPMPCRPYEIISSEGPVEKTACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLEVTDHHRD
Molecular weight 41.38 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type His693-Asp1030
Aliases /Synonyms Genome polyprotein, N-terminal protease, N-pro, 3.4.22.-, Autoprotease p20, Capsid protein C, E(rns) glycoprotein, gp44/48, Envelope glycoprotein E1, gp33, Envelope glycoprotein E2, gp55, Viroporin p7, Non-structural protein 2-3, Cysteine protease NS2, 3.4.22.-, Non-structural protein 2, Serine protease NS3, 3.4.21.113, 3.6.1.15, 3.6.4.13, Non-structural protein 3, Non-structural protein 4A, NS4A, Non-structural protein 4B, NS4B, Non-structural protein 5A, NS5A, RNA-directed RNA polymerase, 2.7.7.48, NS5B, Bovine viral diarrhea virus (BVDV)
Reference PX-P6241
Note For research use only
Molecular Constructor
His693–Asp1030 His

Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) Envelope glycoprotein E2 recombinant protein

There are no reviews yet.

Be the first to review “Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) Envelope glycoprotein E2 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products