Brand: ProteoGenix

Burosumab Biosimilar – Anti-FGF23 mAb – Research Grade

PX-TA1437-50
Validated ELISA

Clonality:: Monoclonal Antibody
Isotype:: IgG1, kappa

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points

Size Size

50ug Original price was: $200.00.Current price is: $167.00.
100ug Original price was: $300.00.Current price is: $238.00.
1MG Original price was: $602.00.Current price is: $482.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade

Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade

Product name	Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade
Uniprot ID	Q9GZV9
Source	Drugbank DB14012
Species	Homo sapiens
Raw Antigen Sequence	MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Burosumab,KRN-23,UX-023,FGF23,anti-FGF23
Reference	PX-TA1437
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade
Uniprot ID	Q9GZV9
Source	Drugbank DB14012
Species	Homo sapiens
Raw Antigen Sequence	MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Burosumab,KRN-23,UX-023,FGF23,anti-FGF23
Reference	PX-TA1437
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	PX-TA1437-50
Uniprot ID	Q9GZV9
Source	Drugbank DB14012
Species	Homo sapiens
Raw Antigen Sequence	MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Aliases /Synonyms	Burosumab,KRN-23,UX-023,FGF23,anti-FGF23
Reference	PX-TA1437
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody

General information on Anti-FGF23[Homo sapiens] (Burosumab) Monoclonal Antibody

Burosumab is an human monoclonal IgG1 antibody that targets excess fibroblast growth factor 23 (FGF23) and has been investigated to treat children suffering from X-linked hypophosphatemic rickets.

SDS-PAGE for Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade

Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade binds to Recombinant Mouse FGF23 Protein, N-His in ELISA Assay

Recombinant Mouse FGF23 Protein, N-His(cat. No.ARO-P10471) at 0.5Âµg/mL (100ÂµL/well) can bind Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Burosumab Biosimilar – Anti-FGF23 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Burosumab Biosimilar – Anti-FGF23 mAb – Research Grade

Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade

General information on Anti-FGF23[Homo sapiens] (Burosumab) Monoclonal Antibody

SDS-PAGE for Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade

Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade binds to Recombinant Mouse FGF23 Protein, N-His in ELISA Assay

Related products

Fibroblast growth factor 23(FGF23)

Human IgG1 LALA Isotype Control antibody (HyHEL-10)

Anti-Burosumab ELISA Kit

Anti-Human FGF23 Antibody (SAA0441)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Burosumab Biosimilar – Anti-FGF23 mAb – Research Grade

Specifications Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade

Description

General information on Anti-FGF23[Homo sapiens] (Burosumab) Monoclonal Antibody

Documents

QC & Validation

SDS-PAGE for Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade

Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade binds to Recombinant Mouse FGF23 Protein, N-His in ELISA Assay

3D Representation

Reviews

Related products

Fibroblast growth factor 23(FGF23)

Human IgG1 LALA Isotype Control antibody (HyHEL-10)

Anti-Burosumab ELISA Kit

Anti-Human FGF23 Antibody (SAA0441)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Burosumab Biosimilar - Anti-FGF23 mAb - Research Grade