Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

CD200 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P41217
Molecular weight:
25.52 kDa

Original price was: $595.00.Current price is: $500.00.

100ug 16% OFF + 500 loyalty points
Met1–Gly232 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
CD200 recombinant protein

CD200 recombinant protein

Product name PX-P5207-100
Uniprot ID P41217
Uniprot link https://www.uniprot.org/uniprot/P41217
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
Molecular weight 25.52 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly232
Protein Accession P41217
Aliases /Synonyms MOX1, MOX2
Reference PX-P5207
Note For research use only
Molecular Constructor
Met1–Gly232 His
Product name PX-P5207-1MG
Uniprot ID P41217
Uniprot link https://www.uniprot.org/uniprot/P41217
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
Molecular weight 25.52 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly232
Protein Accession P41217
Aliases /Synonyms MOX1, MOX2
Reference PX-P5207
Note For research use only
Molecular Constructor
Met1–Gly232 His
Product name PX-P5207-50
Uniprot ID P41217
Uniprot link https://www.uniprot.org/uniprot/P41217
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
Molecular weight 25.52 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly232
Protein Accession P41217
Aliases /Synonyms MOX1, MOX2
Reference PX-P5207
Note For research use only
Molecular Constructor
Met1–Gly232 His

CD200 recombinant protein

There are no reviews yet.

Be the first to review “CD200 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products