Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD272 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q7Z6A9
Molecular weight:
32kDa

Original price was: $302.00.Current price is: $265.00.

50ug 12% OFF + 265 loyalty points
Met1~Ser150 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD272 Recombinant Protein

Product name PX-P4114-100
Uniprot ID Q7Z6A9
Uniprot link http://www.uniprot.org/uniprot/Q7Z6A9
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser150
Aliases /Synonyms /
Reference PX-P4114
Note For research use only
Molecular Constructor
Met1~Ser150 His
Product name PX-P4114-1MG
Uniprot ID Q7Z6A9
Uniprot link http://www.uniprot.org/uniprot/Q7Z6A9
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser150
Aliases /Synonyms /
Reference PX-P4114
Note For research use only
Molecular Constructor
Met1~Ser150 His
Product name PX-P4114-50
Uniprot ID Q7Z6A9
Uniprot link http://www.uniprot.org/uniprot/Q7Z6A9
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser150
Aliases /Synonyms /
Reference PX-P4114
Note For research use only
Molecular Constructor
Met1~Ser150 His

General Information about CD272 Recombinant Protein

CD272 (cluster of differentiation 272) is also designated as BTLA. BTLA expression is induced during T cell activation and BTLA is still expressed on Th1 cells instead of Th2 cells. Like PD1 and CTLA4, BTLA interacts with homologs B7 and B7H4. However, unlike PD-1 and CTLA-4, BTLA exhibits an inhibitory effect on T lymphocytes by interacting with familial neurotic tumor receptors (TNF-R), not just with cell surface receptors. Family interaction. BTLA is a linker of tumor necrosis factor 14 superfamily member (receptor) (TNFRSF14) and is also known as herpes virus mediator (HVEM). The BTLA-HVEM complex negatively regulates the immune response of T cells. Activation of BTLA inhibits the function of cancer-specific human CD8 + T cells.

CD272 Recombinant Protein

There are no reviews yet.

Be the first to review “CD272 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products