Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD69, N-His, recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q07108
Molecular weight:
18.28 kDa

$392.00

100ug + 392 loyalty points
His Ser62–Lys199
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD69, N-His, recombinant protein

Product name CD69, N-His, recombinant protein
Uniprot ID Q07108
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
Molecular weight 18.28 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser62-Lys199
Protein Accession Q07108
Reference PX-P5631
Note For research use only
Molecular Constructor
His Ser62–Lys199

CD69, N-His, recombinant protein

There are no reviews yet.

Be the first to review “CD69, N-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products